PDB entry 4a4i

View 4a4i on RCSB PDB site
Description: Crystal structure of the human Lin28b cold shock domain
Class: RNA binding protein
Keywords: RNA binding protein
Deposited on 2011-10-14, released 2012-08-08
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-09-05, with a file datestamp of 2012-08-31.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.18367
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein lin-28 homolog b
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4a4ia_
  • Chain 'B':
    Compound: protein lin-28 homolog b
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4a4ib_
  • Heterogens: GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4a4iA (A:)
    gsesqvlrgtghckwfnvrmgfgfisminregspldipvdvfvhqsklfmegfrslkege
    pveftfkksskglesirvtgpggspclgse
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a4iA (A:)
    vlrgtghckwfnvrmgfgfisminregspldipvdvfvhqsklfmegfrslkegepveft
    fkksskglesirvtgpggspclgs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4a4iB (B:)
    gsesqvlrgtghckwfnvrmgfgfisminregspldipvdvfvhqsklfmegfrslkege
    pveftfkksskglesirvtgpggspclgse
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a4iB (B:)
    vlrgtghckwfnvrmgfgfisminregspldipvdvfvhqsklfmegfrslkegepveft
    fkksskglesirvtgpggspclgse