PDB entry 4a4g

View 4a4g on RCSB PDB site
Description: Solution structure of SMN Tudor domain in complex with asymmetrically dimethylated arginine
Class: RNA binding protein
Keywords: RNA binding protein
Deposited on 2011-10-12, released 2011-11-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-11-06, with a file datestamp of 2013-11-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Survival motor neuron protein
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q16637 (0-63)
  Domains in SCOPe 2.08: d4a4ga_
• Heterogens: DA2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4a4gA (A:)
  ntaaslqqwkvgdkcsaiwsedgciypatiasidfkretcvvvytgygnreeqnlsdlls
  pice