PDB entry 4a4e

View 4a4e on RCSB PDB site
Description: Solution structure of SMN Tudor domain in complex with symmetrically dimethylated arginine
Class: RNA binding protein
Keywords: RNA binding protein
Deposited on 2011-10-12, released 2011-11-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-12-28, with a file datestamp of 2011-12-23.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Survival motor neuron protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4a4ea_
  • Heterogens: 2MR

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4a4eA (A:)
    ntaaslqqwkvgdkcsaiwsedgciypatiasidfkretcvvvytgygnreeqnlsdlls
    pice