PDB entry 4a4b

View 4a4b on RCSB PDB site
Description: Structure of modified phosphoTyr371-c-Cbl-UbcH5B-ZAP-70 complex
Class: ligase/transferase
Keywords: ligase-transferase complex
Deposited on 2011-10-08, released 2012-01-25
The last revision prior to the SCOPe 2.01 freeze date was dated 2012-01-25, with a file datestamp of 2012-01-20.
Experiment type: XRAY
Resolution: 2.79 Å
R-factor: 0.1913
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase CBL
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22681 (Start-390)
      • engineered mutation (323)
  • Chain 'B':
    Compound: tyrosine-protein kinase zap-70
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: ubiquitin-conjugating enzyme e2 d2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d4a4bc_
  • Heterogens: ZN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4a4bC (C:)
    malkrihkelndlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfptdy
    pfkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnpddplv
    peiariyktdrekynriarewtqkyam
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a4bC (C:)
    alkrihkelndlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfptdyp
    fkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnpddplvp
    eiariyktdrekynriarewtqkyam