PDB entry 4a49

View 4a49 on RCSB PDB site
Description: Structure of phosphoTyr371-c-Cbl-UbcH5B complex
Class: ligase
Keywords: ligase
Deposited on 2011-10-07, released 2012-01-25
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-02-29, with a file datestamp of 2012-02-24.
Experiment type: XRAY
Resolution: 2.21 Å
R-factor: 0.1699
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase CBL
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22681 (Start-83)
      • engineered mutation (16)
  • Chain 'B':
    Compound: ubiquitin-conjugating enzyme e2 d2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4a49b_
  • Heterogens: ZN, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4a49B (B:)
    malkrihkelndlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfptdy
    pfkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnpddplv
    peiariyktdrekynriarewtqkyam
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a49B (B:)
    alkrihkelndlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfptdyp
    fkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnpddplvp
    eiariyktdrekynriarewtqkyam