PDB entry 4a3h

View 4a3h on RCSB PDB site
Description: 2',4' dinitrophenyl-2-deoxy-2-fluro-b-d-cellobioside complex of the endoglucanase cel5a from bacillus agaradhaerens at 1.6 a resolution
Class: hydrolase
Keywords: hydrolase, cellulose degradation, endoglucanase, glycoside hydrolase family 5, michaelis complex. skew-boat, distortion
Deposited on 1998-07-22, released 1999-07-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.142
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (endoglucanase)
    Species: Bacillus agaradhaerens [TaxId:76935]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06565 (Start-302)
      • conflict (21)
      • conflict (25)
      • conflict (58)
      • conflict (73)
      • conflict (92)
      • conflict (147)
      • conflict (160)
      • conflict (190)
      • conflict (232)
      • conflict (278)
    Domains in SCOPe 2.07: d4a3ha_
  • Heterogens: DCB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4a3hA (A:)
    dndsvveehgqlsisngelvnergeqvqlkgmsshglqwygqfvnyesmkwlrddwginv
    fraamytssggyiddpsvkekvkeaveaaidldiyviidwhilsdndpniykeeakdffd
    emselygdypnviyeianepngsdvtwgnqikpyaeevipiirnndpnniiivgtgtwsq
    dvhhaadnqladpnvmyafhfyagthgqnlrdqvdyaldqgaaifvsewgtsaatgdggv
    fldeaqvwidfmdernlswanwslthkdessaalmpganptggwteaelspsgtfvreki
    res
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a3hA (A:)
    svveehgqlsisngelvnergeqvqlkgmsshglqwygqfvnyesmkwlrddwginvfra
    amytssggyiddpsvkekvkeaveaaidldiyviidwhilsdndpniykeeakdffdems
    elygdypnviyeianepngsdvtwgnqikpyaeevipiirnndpnniiivgtgtwsqdvh
    haadnqladpnvmyafhfyagthgqnlrdqvdyaldqgaaifvsewgtsaatgdggvfld
    eaqvwidfmdernlswanwslthkdessaalmpganptggwteaelspsgtfvrekires