PDB entry 4a34

View 4a34 on RCSB PDB site
Description: Crystal structure of the fucose mutarotase in complex with L-fucose from Streptococcus pneumoniae
Class: isomerase
Keywords: isomerase
Deposited on 2011-09-29, released 2011-10-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-09-04, with a file datestamp of 2013-08-30.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.22822
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rbsd/fucu transport protein family protein
    Species: STREPTOCOCCUS PNEUMONIAE [TaxId:170187]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4a34a_
  • Chain 'B':
    Compound: rbsd/fucu transport protein family protein
    Species: STREPTOCOCCUS PNEUMONIAE [TaxId:170187]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4a34b_
  • Chain 'C':
    Compound: rbsd/fucu transport protein family protein
    Species: STREPTOCOCCUS PNEUMONIAE [TaxId:170187]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4a34c_
  • Chain 'D':
    Compound: rbsd/fucu transport protein family protein
    Species: STREPTOCOCCUS PNEUMONIAE [TaxId:170187]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4a34d_
  • Chain 'E':
    Compound: rbsd/fucu transport protein family protein
    Species: STREPTOCOCCUS PNEUMONIAE [TaxId:170187]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4a34e_
  • Chain 'F':
    Compound: rbsd/fucu transport protein family protein
    Species: STREPTOCOCCUS PNEUMONIAE [TaxId:170187]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4a34f_
  • Chain 'G':
    Compound: rbsd/fucu transport protein family protein
    Species: STREPTOCOCCUS PNEUMONIAE [TaxId:170187]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4a34g_
  • Chain 'H':
    Compound: rbsd/fucu transport protein family protein
    Species: STREPTOCOCCUS PNEUMONIAE [TaxId:170187]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4a34h_
  • Chain 'I':
    Compound: rbsd/fucu transport protein family protein
    Species: STREPTOCOCCUS PNEUMONIAE [TaxId:170187]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4a34i_
  • Chain 'J':
    Compound: rbsd/fucu transport protein family protein
    Species: STREPTOCOCCUS PNEUMONIAE [TaxId:170187]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4a34j_
  • Chain 'K':
    Compound: rbsd/fucu transport protein family protein
    Species: STREPTOCOCCUS PNEUMONIAE [TaxId:170187]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4a34k_
  • Chain 'L':
    Compound: rbsd/fucu transport protein family protein
    Species: STREPTOCOCCUS PNEUMONIAE [TaxId:170187]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4a34l_
  • Chain 'M':
    Compound: rbsd/fucu transport protein family protein
    Species: STREPTOCOCCUS PNEUMONIAE [TaxId:170187]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4a34m_
  • Chain 'N':
    Compound: rbsd/fucu transport protein family protein
    Species: STREPTOCOCCUS PNEUMONIAE [TaxId:170187]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4a34n_
  • Chain 'O':
    Compound: rbsd/fucu transport protein family protein
    Species: STREPTOCOCCUS PNEUMONIAE [TaxId:170187]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4a34o_
  • Chain 'P':
    Compound: rbsd/fucu transport protein family protein
    Species: STREPTOCOCCUS PNEUMONIAE [TaxId:170187]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4a34p_
  • Chain 'Q':
    Compound: rbsd/fucu transport protein family protein
    Species: STREPTOCOCCUS PNEUMONIAE [TaxId:170187]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4a34q_
  • Chain 'R':
    Compound: rbsd/fucu transport protein family protein
    Species: STREPTOCOCCUS PNEUMONIAE [TaxId:170187]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4a34r_
  • Chain 'S':
    Compound: rbsd/fucu transport protein family protein
    Species: STREPTOCOCCUS PNEUMONIAE [TaxId:170187]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4a34s_
  • Chain 'T':
    Compound: rbsd/fucu transport protein family protein
    Species: STREPTOCOCCUS PNEUMONIAE [TaxId:170187]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4a34t_
  • Heterogens: FUL, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4a34A (A:)
    mlkhipknispdllktlmemghgdeivladanypsascanklircdgvnipelldsilyl
    mpldsyvdssiqfmnvvsgddipkiwgtyrqmieghgtdlktitylrredfyerskkaya
    ivatgetslyaniilkkgvvverenvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a34A (A:)
    lkhipknispdllktlmemghgdeivladanypsascanklircdgvnipelldsilylm
    pldsyvdssiqfmnvvsgddipkiwgtyrqmieghgtdlktitylrredfyerskkayai
    vatgetslyaniilkkgvvv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4a34B (B:)
    mlkhipknispdllktlmemghgdeivladanypsascanklircdgvnipelldsilyl
    mpldsyvdssiqfmnvvsgddipkiwgtyrqmieghgtdlktitylrredfyerskkaya
    ivatgetslyaniilkkgvvverenvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a34B (B:)
    lkhipknispdllktlmemghgdeivladanypsascanklircdgvnipelldsilylm
    pldsyvdssiqfmnvvsgddipkiwgtyrqmieghgtdlktitylrredfyerskkayai
    vatgetslyaniilkkgvvv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4a34C (C:)
    mlkhipknispdllktlmemghgdeivladanypsascanklircdgvnipelldsilyl
    mpldsyvdssiqfmnvvsgddipkiwgtyrqmieghgtdlktitylrredfyerskkaya
    ivatgetslyaniilkkgvvverenvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a34C (C:)
    lkhipknispdllktlmemghgdeivladanypsascanklircdgvnipelldsilylm
    pldsyvdssiqfmnvvsgddipkiwgtyrqmieghgtdlktitylrredfyerskkayai
    vatgetslyaniilkkgvvv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4a34D (D:)
    mlkhipknispdllktlmemghgdeivladanypsascanklircdgvnipelldsilyl
    mpldsyvdssiqfmnvvsgddipkiwgtyrqmieghgtdlktitylrredfyerskkaya
    ivatgetslyaniilkkgvvverenvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a34D (D:)
    lkhipknispdllktlmemghgdeivladanypsascanklircdgvnipelldsilylm
    pldsyvdssiqfmnvvsgddipkiwgtyrqmieghgtdlktitylrredfyerskkayai
    vatgetslyaniilkkgvvv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4a34E (E:)
    mlkhipknispdllktlmemghgdeivladanypsascanklircdgvnipelldsilyl
    mpldsyvdssiqfmnvvsgddipkiwgtyrqmieghgtdlktitylrredfyerskkaya
    ivatgetslyaniilkkgvvverenvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a34E (E:)
    lkhipknispdllktlmemghgdeivladanypsascanklircdgvnipelldsilylm
    pldsyvdssiqfmnvvsgddipkiwgtyrqmieghgtdlktitylrredfyerskkayai
    vatgetslyaniilkkgvv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4a34F (F:)
    mlkhipknispdllktlmemghgdeivladanypsascanklircdgvnipelldsilyl
    mpldsyvdssiqfmnvvsgddipkiwgtyrqmieghgtdlktitylrredfyerskkaya
    ivatgetslyaniilkkgvvverenvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a34F (F:)
    lkhipknispdllktlmemghgdeivladanypsascanklircdgvnipelldsilylm
    pldsyvdssiqfmnvvsgddipkiwgtyrqmieghgtdlktitylrredfyerskkayai
    vatgetslyaniilkkgvvv
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4a34G (G:)
    mlkhipknispdllktlmemghgdeivladanypsascanklircdgvnipelldsilyl
    mpldsyvdssiqfmnvvsgddipkiwgtyrqmieghgtdlktitylrredfyerskkaya
    ivatgetslyaniilkkgvvverenvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a34G (G:)
    lkhipknispdllktlmemghgdeivladanypsascanklircdgvnipelldsilylm
    pldsyvdssiqfmnvvsgddipkiwgtyrqmieghgtdlktitylrredfyerskkayai
    vatgetslyaniilkkgvvv
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4a34H (H:)
    mlkhipknispdllktlmemghgdeivladanypsascanklircdgvnipelldsilyl
    mpldsyvdssiqfmnvvsgddipkiwgtyrqmieghgtdlktitylrredfyerskkaya
    ivatgetslyaniilkkgvvverenvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a34H (H:)
    lkhipknispdllktlmemghgdeivladanypsascanklircdgvnipelldsilylm
    pldsyvdssiqfmnvvsgddipkiwgtyrqmieghgtdlktitylrredfyerskkayai
    vatgetslyaniilkkgvvv
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4a34I (I:)
    mlkhipknispdllktlmemghgdeivladanypsascanklircdgvnipelldsilyl
    mpldsyvdssiqfmnvvsgddipkiwgtyrqmieghgtdlktitylrredfyerskkaya
    ivatgetslyaniilkkgvvverenvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a34I (I:)
    lkhipknispdllktlmemghgdeivladanypsascanklircdgvnipelldsilylm
    pldsyvdssiqfmnvvsgddipkiwgtyrqmieghgtdlktitylrredfyerskkayai
    vatgetslyaniilkkgvvver
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4a34J (J:)
    mlkhipknispdllktlmemghgdeivladanypsascanklircdgvnipelldsilyl
    mpldsyvdssiqfmnvvsgddipkiwgtyrqmieghgtdlktitylrredfyerskkaya
    ivatgetslyaniilkkgvvverenvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a34J (J:)
    lkhipknispdllktlmemghgdeivladanypsascanklircdgvnipelldsilylm
    pldsyvdssiqfmnvvsgddipkiwgtyrqmieghgtdlktitylrredfyerskkayai
    vatgetslyaniilkkgvvv
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4a34K (K:)
    mlkhipknispdllktlmemghgdeivladanypsascanklircdgvnipelldsilyl
    mpldsyvdssiqfmnvvsgddipkiwgtyrqmieghgtdlktitylrredfyerskkaya
    ivatgetslyaniilkkgvvverenvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a34K (K:)
    lkhipknispdllktlmemghgdeivladanypsascanklircdgvnipelldsilylm
    pldsyvdssiqfmnvvsgddipkiwgtyrqmieghgtdlktitylrredfyerskkayai
    vatgetslyaniilkkgvvv
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4a34L (L:)
    mlkhipknispdllktlmemghgdeivladanypsascanklircdgvnipelldsilyl
    mpldsyvdssiqfmnvvsgddipkiwgtyrqmieghgtdlktitylrredfyerskkaya
    ivatgetslyaniilkkgvvverenvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a34L (L:)
    lkhipknispdllktlmemghgdeivladanypsascanklircdgvnipelldsilylm
    pldsyvdssiqfmnvvsgddipkiwgtyrqmieghgtdlktitylrredfyerskkayai
    vatgetslyaniilkkgvvv
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4a34M (M:)
    mlkhipknispdllktlmemghgdeivladanypsascanklircdgvnipelldsilyl
    mpldsyvdssiqfmnvvsgddipkiwgtyrqmieghgtdlktitylrredfyerskkaya
    ivatgetslyaniilkkgvvverenvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a34M (M:)
    lkhipknispdllktlmemghgdeivladanypsascanklircdgvnipelldsilylm
    pldsyvdssiqfmnvvsgddipkiwgtyrqmieghgtdlktitylrredfyerskkayai
    vatgetslyaniilkkgvvv
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >4a34N (N:)
    mlkhipknispdllktlmemghgdeivladanypsascanklircdgvnipelldsilyl
    mpldsyvdssiqfmnvvsgddipkiwgtyrqmieghgtdlktitylrredfyerskkaya
    ivatgetslyaniilkkgvvverenvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a34N (N:)
    lkhipknispdllktlmemghgdeivladanypsascanklircdgvnipelldsilylm
    pldsyvdssiqfmnvvsgddipkiwgtyrqmieghgtdlktitylrredfyerskkayai
    vatgetslyaniilkkgvvv
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >4a34O (O:)
    mlkhipknispdllktlmemghgdeivladanypsascanklircdgvnipelldsilyl
    mpldsyvdssiqfmnvvsgddipkiwgtyrqmieghgtdlktitylrredfyerskkaya
    ivatgetslyaniilkkgvvverenvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a34O (O:)
    lkhipknispdllktlmemghgdeivladanypsascanklircdgvnipelldsilylm
    pldsyvdssiqfmnvvsgddipkiwgtyrqmieghgtdlktitylrredfyerskkayai
    vatgetslyaniilkkgvvv
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >4a34P (P:)
    mlkhipknispdllktlmemghgdeivladanypsascanklircdgvnipelldsilyl
    mpldsyvdssiqfmnvvsgddipkiwgtyrqmieghgtdlktitylrredfyerskkaya
    ivatgetslyaniilkkgvvverenvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a34P (P:)
    lkhipknispdllktlmemghgdeivladanypsascanklircdgvnipelldsilylm
    pldsyvdssiqfmnvvsgddipkiwgtyrqmieghgtdlktitylrredfyerskkayai
    vatgetslyaniilkkgvvv
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >4a34Q (Q:)
    mlkhipknispdllktlmemghgdeivladanypsascanklircdgvnipelldsilyl
    mpldsyvdssiqfmnvvsgddipkiwgtyrqmieghgtdlktitylrredfyerskkaya
    ivatgetslyaniilkkgvvverenvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a34Q (Q:)
    lkhipknispdllktlmemghgdeivladanypsascanklircdgvnipelldsilylm
    pldsyvdssiqfmnvvsgddipkiwgtyrqmieghgtdlktitylrredfyerskkayai
    vatgetslyaniilkkgvvv
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >4a34R (R:)
    mlkhipknispdllktlmemghgdeivladanypsascanklircdgvnipelldsilyl
    mpldsyvdssiqfmnvvsgddipkiwgtyrqmieghgtdlktitylrredfyerskkaya
    ivatgetslyaniilkkgvvverenvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a34R (R:)
    lkhipknispdllktlmemghgdeivladanypsascanklircdgvnipelldsilylm
    pldsyvdssiqfmnvvsgddipkiwgtyrqmieghgtdlktitylrredfyerskkayai
    vatgetslyaniilkkgvvv
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >4a34S (S:)
    mlkhipknispdllktlmemghgdeivladanypsascanklircdgvnipelldsilyl
    mpldsyvdssiqfmnvvsgddipkiwgtyrqmieghgtdlktitylrredfyerskkaya
    ivatgetslyaniilkkgvvverenvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a34S (S:)
    lkhipknispdllktlmemghgdeivladanypsascanklircdgvnipelldsilylm
    pldsyvdssiqfmnvvsgddipkiwgtyrqmieghgtdlktitylrredfyerskkayai
    vatgetslyaniilkkgvvv
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >4a34T (T:)
    mlkhipknispdllktlmemghgdeivladanypsascanklircdgvnipelldsilyl
    mpldsyvdssiqfmnvvsgddipkiwgtyrqmieghgtdlktitylrredfyerskkaya
    ivatgetslyaniilkkgvvverenvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a34T (T:)
    lkhipknispdllktlmemghgdeivladanypsascanklircdgvnipelldsilylm
    pldsyvdssiqfmnvvsgddipkiwgtyrqmieghgtdlktitylrredfyerskkayai
    vatgetslyaniilkkgvvv