PDB entry 4a26

View 4a26 on RCSB PDB site
Description: The crystal structure of Leishmania major N5,N10- methylenetetrahydrofolate dehydrogenase/cyclohydrolase
Class: oxidoreductase
Keywords: oxidoreductase, hydrolase, leishmaniasis
Deposited on 2011-09-22, released 2011-10-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-02-08, with a file datestamp of 2012-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.23362
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative c-1-tetrahydrofolate synthase, cytoplasmic
    Species: Leishmania major [TaxId:5664]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4a26a1, d4a26a2
  • Chain 'B':
    Compound: putative c-1-tetrahydrofolate synthase, cytoplasmic
    Species: Leishmania major [TaxId:5664]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4a26b1, d4a26b2
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4a26A (A:)
    ghmpsaqiidgkaiaaairselkdkvaalrelyggrvpglasiivgqrmdskkyvqlkhk
    aaaevgmasfnvelpedisqevlevnveklnndpnchgiivqlplpkhlnenraiekihp
    hkdadallpvnvgllhykgreppftpctakgvivllkrcgiemagkravvlgrsnivgap
    vaallmkenatvtivhsgtstedmidylrtadiviaamgqpgyvkgewikegaavvdvgt
    tpvpdpsrkdgyrlvgdvcfeeaaaraawispvpggvgpmtiamllentleafkaalgvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a26A (A:)
    saqiidgkaiaaairselkdkvaalrelyggrvpglasiivgqrmdskkyvqlkhkaaae
    vgmasfnvelpedisqevlevnveklnndpnchgiivqlplpkhlnenraiekihphkda
    dallpvnvgllhykgreppftpctakgvivllkrcgiemagkravvlgrsnivgapvaal
    lmkenatvtivhsgtstedmidylrtadiviaamgqpgyvkgewikegaavvdvgttpvp
    dpsrkdgyrlvgdvcfeeaaaraawispvpggvgpmtiamllentleafkaalgvs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4a26B (B:)
    ghmpsaqiidgkaiaaairselkdkvaalrelyggrvpglasiivgqrmdskkyvqlkhk
    aaaevgmasfnvelpedisqevlevnveklnndpnchgiivqlplpkhlnenraiekihp
    hkdadallpvnvgllhykgreppftpctakgvivllkrcgiemagkravvlgrsnivgap
    vaallmkenatvtivhsgtstedmidylrtadiviaamgqpgyvkgewikegaavvdvgt
    tpvpdpsrkdgyrlvgdvcfeeaaaraawispvpggvgpmtiamllentleafkaalgvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a26B (B:)
    aqiidgkaiaaairselkdkvaalrelyggrvpglasiivgqrmdskkyvqlkhkaaaev
    gmasfnvelpedisqevlevnveklnndpnchgiivqlplpkhlnenraiekihphkdad
    allpvnvgllhykgreppftpctakgvivllkrcgiemagkravvlgrsnivgapvaall
    mkenatvtivhsgtstedmidylrtadiviaamgqpgyvkgewikegaavvdvgttpvpd
    psgyrlvgdvcfeeaaaraawispvpggvgpmtiamllentleafkaalg