PDB entry 4a1k

View 4a1k on RCSB PDB site
Description: Ykud L,D-transpeptidase
Class: transferase
Keywords: transferase, peptidoglycan synthesis
Deposited on 2011-09-15, released 2012-09-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-17, with a file datestamp of 2018-01-12.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative l, d-transpeptidase ykud
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O34816 (1-164)
      • expression tag (0)
      • engineered mutation (117-118)
    Domains in SCOPe 2.08: d4a1ka1, d4a1ka2, d4a1ka3
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4a1kA (A:)
    gmltyqvkqgdtlnsiaadfristaallqanpslqagltagqsivipglpdpytipyhia
    vsigaktltlslnnrvmktypiavgkiltqtptgefyiinrqrnpggpfgaywlslsaah
    ygihgtnnpasigkavskgcirmhnkdvielasivpngtrvtinr