PDB entry 4a0q

View 4a0q on RCSB PDB site
Description: Activated Conformation of Integrin alpha1 I-Domain mutant
Class: cell adhesion
Keywords: integrin, cell adhesion
Deposited on 2011-09-12, released 2011-10-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-12-28, with a file datestamp of 2011-12-23.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.18583
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: integrin alpha-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56199
      • conflict (88)
      • engineered mutation (179)
    Domains in SCOPe 2.07: d4a0qa_
  • Chain 'B':
    Compound: integrin alpha-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56199
      • conflict (88)
      • engineered mutation (179)
    Domains in SCOPe 2.07: d4a0qb_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4a0qA (A:)
    esstqldivivldgsnsiypwdsvtaflndllermdigpkqtqvgivqygenvthefnln
    kyssteevlvaakkivqrggrqtmtalgtdtarkeafteargarrgvkkvmvivtdgesh
    dnhrlkkviqdcedeniqrfsiailgsynrgnlstekfveeiksiaseptekhffnvsda
    lalvtivktlgerifaleata
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a0qA (A:)
    qldivivldgsnsiypwdsvtaflndllermdigpkqtqvgivqygenvthefnlnkyss
    teevlvaakkivqrggrqtmtalgtdtarkeafteargarrgvkkvmvivtdgeshdnhr
    lkkviqdcedeniqrfsiailgsystekfveeiksiaseptekhffnvsdalalvtivkt
    lgerifa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4a0qB (B:)
    esstqldivivldgsnsiypwdsvtaflndllermdigpkqtqvgivqygenvthefnln
    kyssteevlvaakkivqrggrqtmtalgtdtarkeafteargarrgvkkvmvivtdgesh
    dnhrlkkviqdcedeniqrfsiailgsynrgnlstekfveeiksiaseptekhffnvsda
    lalvtivktlgerifaleata
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a0qB (B:)
    qldivivldgsnsiypwdsvtaflndllermdigpkqtqvgivqygenvthefnlnkyss
    teevlvaakkivqrggrqtmtalgtdtarkeafteargarrgvkkvmvivtdgeshdnhr
    lkkviqdcedeniqrfsiailgsynrgnlstekfveeiksiaseptekhffnvsdalalv
    tivktlgerifa