PDB entry 4a02

View 4a02 on RCSB PDB site
Description: X-ray crystallographic structure of EfCBM33A
Class: chitin binding protein
Keywords: chitin binding protein, chitin degradation, chitin oxidation
Deposited on 2011-09-07, released 2012-01-11
The last revision prior to the SCOPe 2.01 freeze date was dated 2012-01-11, with a file datestamp of 2012-01-06.
Experiment type: XRAY
Resolution: 0.95 Å
R-factor: 0.0964
AEROSPACI score: 1.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chitin binding protein
    Species: ENTEROCOCCUS FAECALIS [TaxId:1351]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d4a02a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4a02A (A:)
    hgyvaspgsraffgssaggnlntnvgraqwepqsieapkntfitgklasagvsgfeplde
    qtatrwhktnittgplditwnltaqhrtaswdyyitkngwnpnqpldiknfdkiasidgk
    qevpnkvvkqtiniptdrkgyhviyavwgigdtvnafyqaidvniq