You accessed the SCOPe website through a deprecated URL; see Help for SCOPe 2.01 for more info on linking to SCOPe.
Showing results for SCOPe 2.06; you can access the page in SCOP 1.75 here.

PDB entry 4M9N

View 4M9N on RCSB PDB site
Description: DNA Polymerase Beta E295K Soaked with dATP
Deposited on 2013-08-14, released 2013-10-16
The last revision was dated 2013-12-18, with a file datestamp of 2013-12-13.
Experiment type: XRAY
Resolution: 2.27 Å
R-factor: 0.195
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase beta
    Species: Homo sapiens [TaxId:9606]
    Gene: POLB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06746 (Start-334)
      • engineered mutation (294)
  • Chain 'D':
    Compound: DNA Downstream Strand
    Species: synthetic, synthetic
  • Chain 'P':
    Compound: DNA primer strand
    Species: synthetic, synthetic
  • Chain 'T':
    Compound: DNA template strand
    Species: synthetic, synthetic
  • Heterogens: NA, MG, DTP, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.06, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >4m9nA (A:)
    mskrkapqetlnggitdmltelanfeknvsqaihkynayrkaasviakyphkiksgaeak
    klpgvgtkiaekideflatgklrklekirqddtsssinfltrvsgigpsaarkfvdegik
    tledlrknedklnhhqriglkyfgdfekripreemlqmqdivlnevkkvdseyiatvcgs
    frrgaessgdmdvllthpsftsestkqpkllhqvveqlqkvhfitdtlskgetkfmgvcq
    lpskndekeyphrridirlipkdqyycgvlyftgsdifnknmrahalekgftinkytirp
    lgvtgvageplpvdsekdifdyiqwkyrepkdrse
    

    Sequence, based on observed residues (ATOM records):
    >4m9nA (A:)
    tlnggitdmltelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtki
    aekideflatgklrklekirqddtsssinfltrvsgigpsaarkfvdegiktledlrkne
    dklnhhqriglkyfgdfekripreemlqmqdivlnevkkvdseyiatvcgsfrrgaessg
    dmdvllthpsftseskllhqvveqlqkvhfitdtlskgetkfmgvcqlpseyphrridir
    lipkdqyycgvlyftgsdifnknmrahtinkytirplgeplpvdsekdifdyrepkdrse
    

  • Chain 'D':
    No sequence available.

  • Chain 'P':
    No sequence available.

  • Chain 'T':
    No sequence available.