You accessed the SCOPe website through a deprecated URL; see Help for SCOPe 2.01 for more info on linking to SCOPe.
Showing results for SCOPe 2.06; you can access the page in SCOP 1.75 here.

PDB entry 4M75

View 4M75 on RCSB PDB site
Description: Crystal structure of Lsm1-7 complex
Class: RNA binding protein
Keywords: Sm Like Protein, RNA splicing, STRUCTURAL PROTEIN, RNA BINDING PROTEIN
Deposited on 2013-08-12, released 2013-10-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-02-19, with a file datestamp of 2014-02-14.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: 0.267
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: U6 snRNA-associated Sm-like protein Lsm1
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: LSM1, SPB8, YJL124C, J0714
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: u6 snrna-associated sm-like protein lsm2
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: LSM2, SMX5, SNP3, YBL026W, YBL0425
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38203 (0-End)
      • engineered mutation (44)
    Domains in SCOPe 2.06: d4m75b_
  • Chain 'C':
    Compound: U6 snRNA-associated Sm-like protein LSm3
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: LSM3, SMX4, USS2, YLR438C-A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P57743
      • engineered mutation (36)
      • engineered mutation (62)
    Domains in SCOPe 2.06: d4m75c_
  • Chain 'D':
    Compound: U6 snRNA-associated Sm-like protein LSm6
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4m75d_
  • Chain 'E':
    Compound: U6 snRNA-associated Sm-like protein LSm5
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: LSM5, YER146W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4m75e_
  • Chain 'F':
    Compound: U6 snRNA-associated Sm-like protein LSm7
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4m75f_
  • Chain 'G':
    Compound: u6 snrna-associated sm-like protein lsm4
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40070 (29-End)
      • expression tag (22-28)
    Domains in SCOPe 2.06: d4m75g1, d4m75g2
  • Chain 'H':
    Compound: U6 snRNA-associated Sm-like protein Lsm1
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: LSM1, SPB8, YJL124C, J0714
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: u6 snrna-associated sm-like protein lsm2
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: LSM2, SMX5, SNP3, YBL026W, YBL0425
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38203 (0-End)
      • engineered mutation (44)
    Domains in SCOPe 2.06: d4m75i_
  • Chain 'J':
    Compound: U6 snRNA-associated Sm-like protein LSm3
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: LSM3, SMX4, USS2, YLR438C-A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P57743
      • engineered mutation (36)
      • engineered mutation (62)
    Domains in SCOPe 2.06: d4m75j_
  • Chain 'K':
    Compound: U6 snRNA-associated Sm-like protein LSm6
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4m75k_
  • Chain 'L':
    Compound: U6 snRNA-associated Sm-like protein LSm5
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: LSM5, YER146W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4m75l_
  • Chain 'M':
    Compound: U6 snRNA-associated Sm-like protein LSm7
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4m75m_
  • Chain 'N':
    Compound: u6 snrna-associated sm-like protein lsm4
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40070 (29-End)
      • expression tag (21-28)
    Domains in SCOPe 2.06: d4m75n1, d4m75n2
  • Heterogens: CL

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4m75B (B:)
    mlffsffktlvdqevvvelkndieikgtlqsvdqflnlkldnisstdekkyphlgsvrni
    firgstvryvylnknmvdtnllqdatrrevmterk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m75B (B:)
    mlffsffktlvdqevvvelkndieikgtlqsvdqflnlkldnisstdekkyphlgsvrni
    firgstvryvylnknmvdtnllqdatrrevm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4m75C (C:)
    metpldllklnldervyiklrgartlvgtlqafdshsnivlsdavetiyqlnneelsese
    rrsemvfirgdtvtlistpsedddgavei
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m75C (C:)
    pldllklnldervyiklrgartlvgtlqafdshsnivlsdavetiyqseserrsemvfir
    gdtvtlistp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4m75D (D:)
    msgkastegsvtteflsdiigktvnvklasgllysgrlesidgfmnvalssatehyesnn
    nkllnkfnsdvflrgtqvmyiseqki
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m75D (D:)
    eflsdiigktvnvklasgllysgrlesidgfmnvalssatehyesnnnkllnkfnsdvfl
    rgtqvmyiseqk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4m75E (E:)
    mslpeilplevidktinqkvlivlqsnrefegtlvgfddfvnviledavewlidpedesr
    nekvmqhhgrmllsgnniailvpggkktpteal
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m75E (E:)
    ilplevidktinqkvlivlqsnrefegtlvgfddfvnviledavewlidsrnekvmqhhg
    rmllsgnniailvpg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4m75F (F:)
    mhqqhsksenkpqqqrkkfegpkreaildlakykdskirvklmggklvigvlkgydqlmn
    lvlddtveymsnpddenntelisknarklgltvirgtilvslssaegsdvlymqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m75F (F:)
    rkkfegpreaildlakykdskirvklmggklvigvlkgydqlmnlvlddtveymsarklg
    ltvirgtilvslssa
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4m75G (G:)
    mkhhhhhhhgaagtslykkagenlyfqgsmlplylltnakgqqmqielkngeiiqgiltn
    vdnwmnltlsnvteyseesainsednaesskavklneiyirgtfikfiklqdniidkvkq
    qi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m75G (G:)
    nlyfqgsmlplylltnakgqqmqielkngeiiqgiltnvdnwmnltlsnvteysvklnei
    yirgtfikfiklqdniidkvkq
    

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4m75I (I:)
    mlffsffktlvdqevvvelkndieikgtlqsvdqflnlkldnisstdekkyphlgsvrni
    firgstvryvylnknmvdtnllqdatrrevmterk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m75I (I:)
    mlffsffktlvdqevvvelkndieikgtlqsvdqflnlkldnisstdkyphlgsvrnifi
    rgstvryvylnknmvdtnllqdatrr
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4m75J (J:)
    metpldllklnldervyiklrgartlvgtlqafdshsnivlsdavetiyqlnneelsese
    rrsemvfirgdtvtlistpsedddgavei
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m75J (J:)
    tpldllklnldervyiklrgartlvgtlqafdshsnivlsdavetiyqleelseserrse
    mvfirgdtvtlistp
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4m75K (K:)
    msgkastegsvtteflsdiigktvnvklasgllysgrlesidgfmnvalssatehyesnn
    nkllnkfnsdvflrgtqvmyiseqki
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m75K (K:)
    svtteflsdiigktvnvklasgllysgrlesidgfmnvalssatehyekllnkfnsdvfl
    rgtqvmyiseq
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4m75L (L:)
    mslpeilplevidktinqkvlivlqsnrefegtlvgfddfvnviledavewlidpedesr
    nekvmqhhgrmllsgnniailvpggkktpteal
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m75L (L:)
    ilplevidktinqkvlivlqsnrefegtlvgfddfvnviledavewlidrnekvmqhhgr
    mllsgnniailvpgg
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4m75M (M:)
    mhqqhsksenkpqqqrkkfegpkreaildlakykdskirvklmggklvigvlkgydqlmn
    lvlddtveymsnpddenntelisknarklgltvirgtilvslssaegsdvlymqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m75M (M:)
    dlakykdskirvklmggklvigvlkgydqlmnlvlddtveymsarklgltvirgtilvsl
    ss
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >4m75N (N:)
    mkhhhhhhhgaagtslykkagenlyfqgsmlplylltnakgqqmqielkngeiiqgiltn
    vdnwmnltlsnvteyseesainsednaesskavklneiyirgtfikfiklqdniidkvkq
    qi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m75N (N:)
    enlyfqgsmlplylltnakgqqmqielkngeiiqgiltnvdnwmnltlsnvtevklneiy
    irgtfikfiklqdniidkvkqq