SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.
You accessed the SCOPe website through a deprecated URL; see Help for SCOPe 2.01 for more info on linking to SCOPe.
Showing results for SCOPe 2.06; you can access the page in SCOP 1.75 here.

PDB entry 4M75

View 4M75 on RCSB PDB site
Description: Crystal structure of Lsm1-7 complex
Class: RNA binding protein
Keywords: Sm Like Protein, RNA splicing, STRUCTURAL PROTEIN, RNA BINDING PROTEIN
Deposited on 2013-08-12, released 2013-10-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-02-19, with a file datestamp of 2014-02-14.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: 0.267
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: U6 snRNA-associated Sm-like protein Lsm1
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: LSM1, SPB8, YJL124C, J0714
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: u6 snrna-associated sm-like protein lsm2
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: LSM2, SMX5, SNP3, YBL026W, YBL0425
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38203 (0-End)
      • engineered mutation (44)
    Domains in SCOPe 2.06: d4m75b_
  • Chain 'C':
    Compound: U6 snRNA-associated Sm-like protein LSm3
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: LSM3, SMX4, USS2, YLR438C-A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P57743
      • engineered mutation (36)
      • engineered mutation (62)
    Domains in SCOPe 2.06: d4m75c_
  • Chain 'D':
    Compound: U6 snRNA-associated Sm-like protein LSm6
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4m75d_
  • Chain 'E':
    Compound: U6 snRNA-associated Sm-like protein LSm5
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: LSM5, YER146W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4m75e_
  • Chain 'F':
    Compound: U6 snRNA-associated Sm-like protein LSm7
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4m75f_
  • Chain 'G':
    Compound: u6 snrna-associated sm-like protein lsm4
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40070 (29-End)
      • expression tag (22-28)
    Domains in SCOPe 2.06: d4m75g1, d4m75g2
  • Chain 'H':
    Compound: U6 snRNA-associated Sm-like protein Lsm1
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: LSM1, SPB8, YJL124C, J0714
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: u6 snrna-associated sm-like protein lsm2
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: LSM2, SMX5, SNP3, YBL026W, YBL0425
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38203 (0-End)
      • engineered mutation (44)
    Domains in SCOPe 2.06: d4m75i_
  • Chain 'J':
    Compound: U6 snRNA-associated Sm-like protein LSm3
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: LSM3, SMX4, USS2, YLR438C-A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P57743
      • engineered mutation (36)
      • engineered mutation (62)
    Domains in SCOPe 2.06: d4m75j_
  • Chain 'K':
    Compound: U6 snRNA-associated Sm-like protein LSm6
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4m75k_
  • Chain 'L':
    Compound: U6 snRNA-associated Sm-like protein LSm5
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: LSM5, YER146W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4m75l_
  • Chain 'M':
    Compound: U6 snRNA-associated Sm-like protein LSm7
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4m75m_
  • Chain 'N':
    Compound: u6 snrna-associated sm-like protein lsm4
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40070 (29-End)
      • expression tag (21-28)
    Domains in SCOPe 2.06: d4m75n1, d4m75n2
  • Heterogens: CL

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4m75B (B:)
    mlffsffktlvdqevvvelkndieikgtlqsvdqflnlkldnisstdekkyphlgsvrni
    firgstvryvylnknmvdtnllqdatrrevmterk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m75B (B:)
    mlffsffktlvdqevvvelkndieikgtlqsvdqflnlkldnisstdekkyphlgsvrni
    firgstvryvylnknmvdtnllqdatrrevm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4m75C (C:)
    metpldllklnldervyiklrgartlvgtlqafdshsnivlsdavetiyqlnneelsese
    rrsemvfirgdtvtlistpsedddgavei
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m75C (C:)
    pldllklnldervyiklrgartlvgtlqafdshsnivlsdavetiyqseserrsemvfir
    gdtvtlistp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4m75D (D:)
    msgkastegsvtteflsdiigktvnvklasgllysgrlesidgfmnvalssatehyesnn
    nkllnkfnsdvflrgtqvmyiseqki
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m75D (D:)
    eflsdiigktvnvklasgllysgrlesidgfmnvalssatehyesnnnkllnkfnsdvfl
    rgtqvmyiseqk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4m75E (E:)
    mslpeilplevidktinqkvlivlqsnrefegtlvgfddfvnviledavewlidpedesr
    nekvmqhhgrmllsgnniailvpggkktpteal
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m75E (E:)
    ilplevidktinqkvlivlqsnrefegtlvgfddfvnviledavewlidsrnekvmqhhg
    rmllsgnniailvpg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4m75F (F:)
    mhqqhsksenkpqqqrkkfegpkreaildlakykdskirvklmggklvigvlkgydqlmn
    lvlddtveymsnpddenntelisknarklgltvirgtilvslssaegsdvlymqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m75F (F:)
    rkkfegpreaildlakykdskirvklmggklvigvlkgydqlmnlvlddtveymsarklg
    ltvirgtilvslssa
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4m75G (G:)
    mkhhhhhhhgaagtslykkagenlyfqgsmlplylltnakgqqmqielkngeiiqgiltn
    vdnwmnltlsnvteyseesainsednaesskavklneiyirgtfikfiklqdniidkvkq
    qi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m75G (G:)
    nlyfqgsmlplylltnakgqqmqielkngeiiqgiltnvdnwmnltlsnvteysvklnei
    yirgtfikfiklqdniidkvkq
    

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4m75I (I:)
    mlffsffktlvdqevvvelkndieikgtlqsvdqflnlkldnisstdekkyphlgsvrni
    firgstvryvylnknmvdtnllqdatrrevmterk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m75I (I:)
    mlffsffktlvdqevvvelkndieikgtlqsvdqflnlkldnisstdkyphlgsvrnifi
    rgstvryvylnknmvdtnllqdatrr
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4m75J (J:)
    metpldllklnldervyiklrgartlvgtlqafdshsnivlsdavetiyqlnneelsese
    rrsemvfirgdtvtlistpsedddgavei
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m75J (J:)
    tpldllklnldervyiklrgartlvgtlqafdshsnivlsdavetiyqleelseserrse
    mvfirgdtvtlistp
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4m75K (K:)
    msgkastegsvtteflsdiigktvnvklasgllysgrlesidgfmnvalssatehyesnn
    nkllnkfnsdvflrgtqvmyiseqki
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m75K (K:)
    svtteflsdiigktvnvklasgllysgrlesidgfmnvalssatehyekllnkfnsdvfl
    rgtqvmyiseq
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4m75L (L:)
    mslpeilplevidktinqkvlivlqsnrefegtlvgfddfvnviledavewlidpedesr
    nekvmqhhgrmllsgnniailvpggkktpteal
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m75L (L:)
    ilplevidktinqkvlivlqsnrefegtlvgfddfvnviledavewlidrnekvmqhhgr
    mllsgnniailvpgg
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4m75M (M:)
    mhqqhsksenkpqqqrkkfegpkreaildlakykdskirvklmggklvigvlkgydqlmn
    lvlddtveymsnpddenntelisknarklgltvirgtilvslssaegsdvlymqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m75M (M:)
    dlakykdskirvklmggklvigvlkgydqlmnlvlddtveymsarklgltvirgtilvsl
    ss
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >4m75N (N:)
    mkhhhhhhhgaagtslykkagenlyfqgsmlplylltnakgqqmqielkngeiiqgiltn
    vdnwmnltlsnvteyseesainsednaesskavklneiyirgtfikfiklqdniidkvkq
    qi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m75N (N:)
    enlyfqgsmlplylltnakgqqmqielkngeiiqgiltnvdnwmnltlsnvtevklneiy
    irgtfikfiklqdniidkvkqq