You accessed the SCOPe website through a deprecated URL; see Help for SCOPe 2.01 for more info on linking to SCOPe.
Showing results for SCOPe 2.06; you can access the page in SCOP 1.75 here.

PDB entry 4KJI

View 4KJI on RCSB PDB site
Description: Novel re-arrangement of an RsmA/cSRa family protein to create a structurally distinct new RNA-binding family member
Deposited on 2013-05-03, released 2013-09-04
The last revision was dated 2013-09-04, with a file datestamp of 2013-08-30.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.226
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RsmN, a RNA-binding protein of Regulator of Secondary Metabolism
    Species: Pseudomonas aeruginosa [TaxId:208963]
    Gene: PA14_68470, rsmN
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: RsmN, a RNA-binding protein of Regulator of Secondary Metabolism
    Species: Pseudomonas aeruginosa [TaxId:208963]
    Gene: PA14_68470, rsmN
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: RsmZ-2
    Species: synthetic, synthetic
  • Chain 'D':
    Compound: RsmZ-2
    Species: synthetic, synthetic

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.06, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >4kjiA (A:)
    hhhhhhgsmgflilsrregegitlslkadypaeelirqlreggirilvtdiignqarvgi
    eaprgvlivrdelktapkg
    

    Sequence, based on observed residues (ATOM records):
    >4kjiA (A:)
    flilsrregegitlslkadypaeelirqlreggirilvtdiignqarvgieaprgvlivr
    delk
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >4kjiB (B:)
    hhhhhhgsmgflilsrregegitlslkadypaeelirqlreggirilvtdiignqarvgi
    eaprgvlivrdelktapkg
    

    Sequence, based on observed residues (ATOM records):
    >4kjiB (B:)
    gflilsrregegitlslkadypaeelirqlreggirilvtdiignqarvgieaprgvliv
    rdelk
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.