You accessed the SCOPe website through a deprecated URL; see Help for SCOPe 2.01 for more info on linking to SCOPe.
Showing results for SCOPe 2.06; you can access the page in SCOP 1.75 here.

PDB entry 4KJA

View 4KJA on RCSB PDB site
Description: Control of ribosomal subunit rotation by elongation factor G
Deposited on 2013-05-03, released 2013-07-17
The last revision was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.215
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 16s rRNA
    Species: Escherichia coli [TaxId:83333]
  • Chain 'B':
    Compound: 30S ribosomal protein S2
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: 30S ribosomal protein S3
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: 30S ribosomal protein S4
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: 30S ribosomal protein S5
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: 30S ribosomal protein S6
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: 30S ribosomal protein S7
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: 30S ribosomal protein S8
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: 30S ribosomal protein S9
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: 30S ribosomal protein S10
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: 30S ribosomal protein S11
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: 30S ribosomal protein S12
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: 30S ribosomal protein S13
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: 30S ribosomal protein S14
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: 30S ribosomal protein S15
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
  • Chain 'P':
    Compound: 30S ribosomal protein S16
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: 30S ribosomal protein S17
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
  • Chain 'R':
    Compound: 30S ribosomal protein S18
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
  • Chain 'S':
    Compound: 30S ribosomal protein S19
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
  • Chain 'T':
    Compound: 30S ribosomal protein S20
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
  • Chain 'U':
    Compound: 30S ribosomal protein S21
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
  • Chain 'V':
    Compound: Elongation factor G
    Species: Escherichia coli [TaxId:83333]
    Gene: fusA
    Database cross-references and differences (RAF-indexed):
  • Chain 'W':
    Compound: Viomycin
    Species: Streptomyces, synthetic [TaxId:1883]
    Database cross-references and differences (RAF-indexed):
    • NOR NOR00633 (0-5)
  • Heterogens: MG, GCP, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.06, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records:
    >4kjaB (B:)
    matvsmrdmlkagvhfghqtrywnpkmkpfifgarnkvhiinlektvpmfnealaelnki
    asrkgkilfvgtkraaseavkdaalscdqffvnhrwlggmltnwktvrqsikrlkdletq
    sqdgtfdkltkkealmrtreleklenslggikdmgglpdalfvidadhehiaikeannlg
    ipvfaivdtnsdpdgvdfvipgnddairavtlylgavaatvregrsqdlasqaeesfvea
    e
    

    Sequence, based on observed residues (ATOM records):
    >4kjaB (B:)
    mlkagvhfghqtrywnpkmkpfifgarnkvhiinlektvpmfnealaelnkiasrkgkil
    fvgtkraaseavkdaalscdqffvnhrwlggmltnwktvrqsikrlkdletqsqdgtfdk
    ltkkealmrtreleklenslggikdmgglpdalfvidadhehiaikeannlgipvfaivd
    tnsdpdgvdfvipgnddairavtlylgavaatvregrs
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >4kjaC (C:)
    mgqkvhpngirlgivkpwnstwfantkefadnldsdfkvrqyltkelakasvsrivierp
    aksirvtihtarpgivigkkgedveklrkvvadiagvpaqiniaevrkpeldaklvadsi
    tsqlerrvmfrramkravqnamrlgakgikvevsgrlggaeiartewyregrvplhtlra
    didyntseahttygvigvkvwifkgeilggmaaveqpekpaaqpkkqqrkgrk
    

    Sequence, based on observed residues (ATOM records):
    >4kjaC (C:)
    gqkvhpngirlgivkpwnstwfantkefadnldsdfkvrqyltkelakasvsrivierpa
    ksirvtihtarpgivigkkgedveklrkvvadiagvpaqiniaevrkpeldaklvadsit
    sqlerrvmfrramkravqnamrlgakgikvevsgrlggaeiartewyregrvplhtlrad
    idyntseahttygvigvkvwifkgei
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >4kjaD (D:)
    marylgpklklsrregtdlflksgvraidtkckieqapgqhgarkprlsdygvqlrekqk
    vrriygvlerqfrnyykeaarlkgntgenllallegrldnvvyrmgfgatraearqlvsh
    kaimvngrvvniasyqvspndvvsirekakkqsrvkaalelaeqrekptwlevdagkmeg
    tfkrkpersdlsadinehlivelysk
    

    Sequence, based on observed residues (ATOM records):
    >4kjaD (D:)
    arylgpklklsrregtdlflksgvraidtkckieqapgqhgarkprlsdygvqlrekqkv
    rriygvlerqfrnyykeaarlkgntgenllallegrldnvvyrmgfgatraearqlvshk
    aimvngrvvniasyqvspndvvsirekakkqsrvkaalelaeqrekptwlevdagkmegt
    fkrkpersdlsadinehlivelysk
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >4kjaE (E:)
    mahiekqagelqekliavnrvsktvkggrifsftaltvvgdgngrvgfgygkarevpaai
    qkamekarrnminvalnngtlqhpvkgvhtgsrvfmqpasegtgiiaggamravlevagv
    hnvlakaygstnpinvvratidglenmnspemvaakrgksveeilgk
    

    Sequence, based on observed residues (ATOM records):
    >4kjaE (E:)
    elqekliavnrvsktvkggrifsftaltvvgdgngrvgfgygkarevpaaiqkamekarr
    nminvalnngtlqhpvkgvhtgsrvfmqpasegtgiiaggamravlevagvhnvlakayg
    stnpinvvratidglenmnspemvaakrgk
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >4kjaF (F:)
    mrhyeivfmvhpdqseqvpgmierytaaitgaegkihrledwgrrqlaypinklhkahyv
    lmnveapqevidelettfrfndavirsmvmrtkhavteaspmvkakderrerrddfanet
    addaeagdseeeeee
    

    Sequence, based on observed residues (ATOM records):
    >4kjaF (F:)
    mrhyeivfmvhpdqseqvpgmierytaaitgaegkihrledwgrrqlaypinklhkahyv
    lmnveapqevidelettfrfndavirsmvmrtkhavteas
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >4kjaG (G:)
    mprrrvigqrkilpdpkfgsellakfvnilmvdgkkstaesivysaletlaqrsgksele
    afevalenvrptvevksrrvggstyqvpvevrpvrrnalamrwiveaarkrgdksmalrl
    anelsdaaenkgtavkkredvhrmaeankafahyrwlslrsfshqagasskqpalgyln
    

    Sequence, based on observed residues (ATOM records):
    >4kjaG (G:)
    prrrvigqrkilpdpkfgsellakfvnilmvdgkkstaesivysaletlaqrsgkselea
    fevalenvrptvevksrrvggstyqvpvevrpvrrnalamrwiveaarkrgdksmalrla
    nelsdaaenkgtavkkredvhrmaeankafa
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >4kjaH (H:)
    msmqdpiadmltrirngqaankaavtmpssklkvaianvlkeegfiedfkvegdtkpele
    ltlkyfqgkavvesiqrvsrpglriykrkdelpkvmaglgiavvstskgvmtdraarqag
    lggeiicyva
    

    Sequence, based on observed residues (ATOM records):
    >4kjaH (H:)
    smqdpiadmltrirngqaankaavtmpssklkvaianvlkeegfiedfkvegdtkpelel
    tlkyfqgkavvesiqrvsrpglriykrkdelpkvmaglgiavvstskgvmtdraarqagl
    ggeiicyva
    

  • Chain 'I':
    Sequence, based on SEQRES records:
    >4kjaI (I:)
    maenqyygtgrrkssaarvfikpgngkivinqrsleqyfgretarmvvrqplelvdmvek
    ldlyitvkgggisgqagairhgitralmeydeslrselrkagfvtrdarqverkkvglrk
    arrrpqfskr
    

    Sequence, based on observed residues (ATOM records):
    >4kjaI (I:)
    nqyygtgrrkssaarvfikpgngkivinqrsleqyfgretarmvvrqplelvdmvekldl
    yitvkgggisgqagairhgitralmeydeslrselrkagfvtrdarqverkkvglrkarr
    rpqfskr
    

  • Chain 'J':
    Sequence, based on SEQRES records:
    >4kjaJ (J:)
    mqnqririrlkafdhrlidqataeivetakrtgaqvrgpiplptrkerftvlisphvnkd
    ardqyeirthlrlvdiveptektvdalmrldlaagvdvqislg
    

    Sequence, based on observed residues (ATOM records):
    >4kjaJ (J:)
    ririrlkafdhrlidqataeivetakrtgaqvrgpiplptrkerftvlisphvnkdardq
    yeirthlrlvdiveptektvdalmrldlaagvdvqisl
    

  • Chain 'K':
    Sequence, based on SEQRES records:
    >4kjaK (K:)
    makapirarkrvrkqvsdgvahihasfnntivtitdrqgnalgwataggsgfrgsrkstp
    faaqvaaercadavkeygiknlevmvkgpgpgrestiralnaagfritnitdvtpiphng
    crppkkrrv
    

    Sequence, based on observed residues (ATOM records):
    >4kjaK (K:)
    rkqvsdgvahihasfnntivtitdrqgnalgwataggsgfrgsrkstpfaaqvaaercad
    avkeygiknlevmvkgpgpgrestiralnaagfritnitdvtpiphngcrppkkrrv
    

  • Chain 'L':
    Sequence, based on SEQRES records:
    >4kjaL (L:)
    matvnqlvrkprarkvaksnvpaleacpqkrgvctrvytttpkkpnsalrkvcrvrltng
    fevtsyiggeghnlqehsvilirggrvkdlpgvryhtvrgaldcsgvkdrkqarskygvk
    rpka
    

    Sequence, based on observed residues (ATOM records):
    >4kjaL (L:)
    atvnqlvrkprarkvaksnvpaleacpqkrgvctrvytttpkkpnsalrkvcrvrltngf
    evtsyiggeghnlqehsvilirggrvkdlpgvryhtvrgaldcsgvkdrkqarskygvkr
    pka
    

  • Chain 'M':
    Sequence, based on SEQRES records:
    >4kjaM (M:)
    mariaginipdhkhavialtsiygvgktrskailaaagiaedvkiselsegqidtlrdev
    akfvvegdlrreismsikrlmdlgcyrglrhrrglpvrgqrtktnartrkgprkpikk
    

    Sequence, based on observed residues (ATOM records):
    >4kjaM (M:)
    ariaginipdhkhavialtsiygvgktrskailaaagiaedvkiselsegqidtlrdeva
    kfvvegdlrreismsikrlmdlgcyrglrhrrglpvrgqrtktnartrkgprkp
    

  • Chain 'N':
    Sequence, based on SEQRES records:
    >4kjaN (N:)
    makqsmkarevkrvaladkyfakraelkaiisdvnasdedrwnavlklqtlprdsspsrq
    rnrcrqtgrphgflrkfglsrikvreaamrgeipglkkasw
    

    Sequence, based on observed residues (ATOM records):
    >4kjaN (N:)
    akqsmkarevkrvaladkyfakraelkaiisdvnarwnavlklqtlprdsspsrqrnrcr
    qtgrphgflrkfglsrikvreaamrgeipglkkasw
    

  • Chain 'O':
    Sequence, based on SEQRES records:
    >4kjaO (O:)
    mslsteatakivsefgrdandtgstevqvalltaqinhlqghfaehkkdhhsrrgllrmv
    sqrrklldylkrkdvarytqlierlglrr
    

    Sequence, based on observed residues (ATOM records):
    >4kjaO (O:)
    slsteatakivsefgrdandtgstevqvalltaqinhlqghfaehkkdhhsrrgllrmvs
    qrrklldylkrkdvarytqlierlglrr
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records:
    >4kjaP (P:)
    mvtirlarhgakkrpfyqvvvadsrnarngrfiervgffnpiasekeegtrldldriahw
    vgqgatisdrvaalikevnkaa
    

  • Chain 'Q':
    Sequence, based on SEQRES records:
    >4kjaQ (Q:)
    mtdkirtlqgrvvsdkmeksivvaierfvkhpiygkfikrttklhvhdennecgigdvve
    irecrplsktkswtlvrvvekavl
    

    Sequence, based on observed residues (ATOM records):
    >4kjaQ (Q:)
    kirtlqgrvvsdkmeksivvaierfvkhpiygkfikrttklhvhdennecgigdvveire
    crplsktkswtlvrvvekav
    

  • Chain 'R':
    Sequence, based on SEQRES records:
    >4kjaR (R:)
    maryfrrrkfcrftaegvqeidykdiatlknyitesgkivpsritgtrakyqrqlaraik
    rarylsllpytdrhq
    

    Sequence, based on observed residues (ATOM records):
    >4kjaR (R:)
    eidykdiatlknyitesgkivpsritgtrakyqrqlaraikrarylsllpytdrh
    

  • Chain 'S':
    Sequence, based on SEQRES records:
    >4kjaS (S:)
    mprslkkgpfidlhllkkvekavesgdkkplrtwsrrstifpnmigltiavhngrqhvpv
    fvtdemvghklgefaptrtyrghaadkkakkk
    

    Sequence, based on observed residues (ATOM records):
    >4kjaS (S:)
    rslkkgpfidlhllkkvekavesgdkkplrtwsrrstifpnmigltiavhngrqhvpvfv
    tdemvghklgefaptrtyr
    

  • Chain 'T':
    Sequence, based on SEQRES records:
    >4kjaT (T:)
    maniksakkraiqsekarkhnasrrsmmrtfikkvyaaieagdkaaaqkafnemqpivdr
    qaakglihknkaarhkanltaqinkla
    

    Sequence, based on observed residues (ATOM records):
    >4kjaT (T:)
    niksakkraiqsekarkhnasrrsmmrtfikkvyaaieagdkaaaqkafnemqpivdrqa
    akglihknkaarhkanltaqinkla
    

  • Chain 'U':
    Sequence, based on SEQRES records:
    >4kjaU (U:)
    mpvikvrenepfdvalrrfkrscekagvlaevrrrefyekptterkrakasavkrhakkl
    arenarrtrly
    

    Sequence, based on observed residues (ATOM records):
    >4kjaU (U:)
    ikvrenepfdvalrrfkrscekagvlaevrrrefyekptterkrakasavk
    

  • Chain 'V':
    Sequence, based on SEQRES records:
    >4kjaV (V:)
    marttpiaryrnigisahidagktttterilfytgvnhkigevhdgaatmdwmeqeqerg
    ititsaattafwsgmakqyephriniidtpghvdftieversmrvldgavmvycavggvq
    pqsetvwrqankykvpriafvnkmdrmganflkvvnqiktrlganpvplqlaigaeehft
    gvvdlvkmkainwndadqgvtfeyedipadmvelanewhqnliesaaeaseelmekylgg
    eelteaeikgalrqrvlnneiilvtcgsafknkgvqamldavidylpspvdvpaingild
    dgkdtpaerhasddepfsalafkiatdpfvgnltffrvysgvvnsgdtvlnsvkaarerf
    grivqmhankreeikevragdiaaaiglkdvttgdtlcdpdapiilermefpepvisiav
    epktkadqekmglalgrlakedpsfrvwtdeesnqtiiagmgelhldiivdrmkrefnve
    anvgkpqvayretirqkvtdvegkhakqsggrgqyghvvidmyplepgsnpkgyefindi
    kggvipgeyipavdkgiqeqlkagplagypvvdmgirlhfgsyhdvdsselafklaasia
    fkegfkkakpvllepimkvevetpeentgdvigdlsrrrgmlkgqesevtgvkihaevpl
    semfgyatqlrsltkgrasytmeflkydeapsnvaqavieargk
    

    Sequence, based on observed residues (ATOM records):
    >4kjaV (V:)
    arttpiaryrnigisahidagktttterilfytgvnatmdwmeqeqergititsaattaf
    wsgmakqyephriniidtpghvdftieversmrvldgavmvycavggvqpqsetvwrqan
    kykvpriafvnkmdrmganflkvvnqiktrlganpvplqlaigaeehftgvvdlvkmkai
    nwndadqgvtfeyedipadmvelanewhqnliesaaeaseelmekylggeelteaeikga
    lrqrvlnneiilvtcgsafknkgvqamldavidylpspvdvpaingilddgkdtpaerha
    sddepfsalafkiatdpfvgnltffrvysgvvnsgdtvlnsvkaarerfgrivqmhankr
    eeikevragdiaaaiglkdvttgdtlcdpdapiilermefpepvisiavepktkadqekm
    glalgrlakedpsfrvwtdeesnqtiiagmgelhldiivdrmkrefnveanvgkpqvayr
    etirqkvtdvegkhakqsggrgqyghvvidmyplepgsnpkgyefindikggvipgeyip
    avdkgiqeqlkagplagypvvdmgirlhfgsyhdvdsselafklaasiafkegfkkakpv
    llepimkvevetpeentgdvigdlsrrrgmlkgqesevtgvkihaevplsemfgyatqlr
    sltkgrasytmeflkydeapsnvaqavie
    

  • Chain 'W':
    Sequence; same for both SEQRES and ATOM records:
    >4kjaW (W:)
    xassxx