SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.
You accessed the SCOPe website through a deprecated URL; see Help for SCOPe 2.01 for more info on linking to SCOPe.
Showing results for SCOPe 2.06; you can access the page in SCOP 1.75 here.

PDB entry 4KJA

View 4KJA on RCSB PDB site
Description: Control of ribosomal subunit rotation by elongation factor G
Deposited on 2013-05-03, released 2013-07-17
The last revision was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.215
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 16s rRNA
    Species: Escherichia coli [TaxId:83333]
  • Chain 'B':
    Compound: 30S ribosomal protein S2
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: 30S ribosomal protein S3
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: 30S ribosomal protein S4
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: 30S ribosomal protein S5
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: 30S ribosomal protein S6
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: 30S ribosomal protein S7
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: 30S ribosomal protein S8
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: 30S ribosomal protein S9
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: 30S ribosomal protein S10
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: 30S ribosomal protein S11
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: 30S ribosomal protein S12
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: 30S ribosomal protein S13
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: 30S ribosomal protein S14
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: 30S ribosomal protein S15
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
  • Chain 'P':
    Compound: 30S ribosomal protein S16
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: 30S ribosomal protein S17
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
  • Chain 'R':
    Compound: 30S ribosomal protein S18
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
  • Chain 'S':
    Compound: 30S ribosomal protein S19
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
  • Chain 'T':
    Compound: 30S ribosomal protein S20
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
  • Chain 'U':
    Compound: 30S ribosomal protein S21
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
  • Chain 'V':
    Compound: Elongation factor G
    Species: Escherichia coli [TaxId:83333]
    Gene: fusA
    Database cross-references and differences (RAF-indexed):
  • Chain 'W':
    Compound: Viomycin
    Species: Streptomyces, synthetic [TaxId:1883]
    Database cross-references and differences (RAF-indexed):
    • NOR NOR00633 (0-5)
  • Heterogens: MG, GCP, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.06, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records:
    >4kjaB (B:)
    matvsmrdmlkagvhfghqtrywnpkmkpfifgarnkvhiinlektvpmfnealaelnki
    asrkgkilfvgtkraaseavkdaalscdqffvnhrwlggmltnwktvrqsikrlkdletq
    sqdgtfdkltkkealmrtreleklenslggikdmgglpdalfvidadhehiaikeannlg
    ipvfaivdtnsdpdgvdfvipgnddairavtlylgavaatvregrsqdlasqaeesfvea
    e
    

    Sequence, based on observed residues (ATOM records):
    >4kjaB (B:)
    mlkagvhfghqtrywnpkmkpfifgarnkvhiinlektvpmfnealaelnkiasrkgkil
    fvgtkraaseavkdaalscdqffvnhrwlggmltnwktvrqsikrlkdletqsqdgtfdk
    ltkkealmrtreleklenslggikdmgglpdalfvidadhehiaikeannlgipvfaivd
    tnsdpdgvdfvipgnddairavtlylgavaatvregrs
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >4kjaC (C:)
    mgqkvhpngirlgivkpwnstwfantkefadnldsdfkvrqyltkelakasvsrivierp
    aksirvtihtarpgivigkkgedveklrkvvadiagvpaqiniaevrkpeldaklvadsi
    tsqlerrvmfrramkravqnamrlgakgikvevsgrlggaeiartewyregrvplhtlra
    didyntseahttygvigvkvwifkgeilggmaaveqpekpaaqpkkqqrkgrk
    

    Sequence, based on observed residues (ATOM records):
    >4kjaC (C:)
    gqkvhpngirlgivkpwnstwfantkefadnldsdfkvrqyltkelakasvsrivierpa
    ksirvtihtarpgivigkkgedveklrkvvadiagvpaqiniaevrkpeldaklvadsit
    sqlerrvmfrramkravqnamrlgakgikvevsgrlggaeiartewyregrvplhtlrad
    idyntseahttygvigvkvwifkgei
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >4kjaD (D:)
    marylgpklklsrregtdlflksgvraidtkckieqapgqhgarkprlsdygvqlrekqk
    vrriygvlerqfrnyykeaarlkgntgenllallegrldnvvyrmgfgatraearqlvsh
    kaimvngrvvniasyqvspndvvsirekakkqsrvkaalelaeqrekptwlevdagkmeg
    tfkrkpersdlsadinehlivelysk
    

    Sequence, based on observed residues (ATOM records):
    >4kjaD (D:)
    arylgpklklsrregtdlflksgvraidtkckieqapgqhgarkprlsdygvqlrekqkv
    rriygvlerqfrnyykeaarlkgntgenllallegrldnvvyrmgfgatraearqlvshk
    aimvngrvvniasyqvspndvvsirekakkqsrvkaalelaeqrekptwlevdagkmegt
    fkrkpersdlsadinehlivelysk
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >4kjaE (E:)
    mahiekqagelqekliavnrvsktvkggrifsftaltvvgdgngrvgfgygkarevpaai
    qkamekarrnminvalnngtlqhpvkgvhtgsrvfmqpasegtgiiaggamravlevagv
    hnvlakaygstnpinvvratidglenmnspemvaakrgksveeilgk
    

    Sequence, based on observed residues (ATOM records):
    >4kjaE (E:)
    elqekliavnrvsktvkggrifsftaltvvgdgngrvgfgygkarevpaaiqkamekarr
    nminvalnngtlqhpvkgvhtgsrvfmqpasegtgiiaggamravlevagvhnvlakayg
    stnpinvvratidglenmnspemvaakrgk
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >4kjaF (F:)
    mrhyeivfmvhpdqseqvpgmierytaaitgaegkihrledwgrrqlaypinklhkahyv
    lmnveapqevidelettfrfndavirsmvmrtkhavteaspmvkakderrerrddfanet
    addaeagdseeeeee
    

    Sequence, based on observed residues (ATOM records):
    >4kjaF (F:)
    mrhyeivfmvhpdqseqvpgmierytaaitgaegkihrledwgrrqlaypinklhkahyv
    lmnveapqevidelettfrfndavirsmvmrtkhavteas
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >4kjaG (G:)
    mprrrvigqrkilpdpkfgsellakfvnilmvdgkkstaesivysaletlaqrsgksele
    afevalenvrptvevksrrvggstyqvpvevrpvrrnalamrwiveaarkrgdksmalrl
    anelsdaaenkgtavkkredvhrmaeankafahyrwlslrsfshqagasskqpalgyln
    

    Sequence, based on observed residues (ATOM records):
    >4kjaG (G:)
    prrrvigqrkilpdpkfgsellakfvnilmvdgkkstaesivysaletlaqrsgkselea
    fevalenvrptvevksrrvggstyqvpvevrpvrrnalamrwiveaarkrgdksmalrla
    nelsdaaenkgtavkkredvhrmaeankafa
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >4kjaH (H:)
    msmqdpiadmltrirngqaankaavtmpssklkvaianvlkeegfiedfkvegdtkpele
    ltlkyfqgkavvesiqrvsrpglriykrkdelpkvmaglgiavvstskgvmtdraarqag
    lggeiicyva
    

    Sequence, based on observed residues (ATOM records):
    >4kjaH (H:)
    smqdpiadmltrirngqaankaavtmpssklkvaianvlkeegfiedfkvegdtkpelel
    tlkyfqgkavvesiqrvsrpglriykrkdelpkvmaglgiavvstskgvmtdraarqagl
    ggeiicyva
    

  • Chain 'I':
    Sequence, based on SEQRES records:
    >4kjaI (I:)
    maenqyygtgrrkssaarvfikpgngkivinqrsleqyfgretarmvvrqplelvdmvek
    ldlyitvkgggisgqagairhgitralmeydeslrselrkagfvtrdarqverkkvglrk
    arrrpqfskr
    

    Sequence, based on observed residues (ATOM records):
    >4kjaI (I:)
    nqyygtgrrkssaarvfikpgngkivinqrsleqyfgretarmvvrqplelvdmvekldl
    yitvkgggisgqagairhgitralmeydeslrselrkagfvtrdarqverkkvglrkarr
    rpqfskr
    

  • Chain 'J':
    Sequence, based on SEQRES records:
    >4kjaJ (J:)
    mqnqririrlkafdhrlidqataeivetakrtgaqvrgpiplptrkerftvlisphvnkd
    ardqyeirthlrlvdiveptektvdalmrldlaagvdvqislg
    

    Sequence, based on observed residues (ATOM records):
    >4kjaJ (J:)
    ririrlkafdhrlidqataeivetakrtgaqvrgpiplptrkerftvlisphvnkdardq
    yeirthlrlvdiveptektvdalmrldlaagvdvqisl
    

  • Chain 'K':
    Sequence, based on SEQRES records:
    >4kjaK (K:)
    makapirarkrvrkqvsdgvahihasfnntivtitdrqgnalgwataggsgfrgsrkstp
    faaqvaaercadavkeygiknlevmvkgpgpgrestiralnaagfritnitdvtpiphng
    crppkkrrv
    

    Sequence, based on observed residues (ATOM records):
    >4kjaK (K:)
    rkqvsdgvahihasfnntivtitdrqgnalgwataggsgfrgsrkstpfaaqvaaercad
    avkeygiknlevmvkgpgpgrestiralnaagfritnitdvtpiphngcrppkkrrv
    

  • Chain 'L':
    Sequence, based on SEQRES records:
    >4kjaL (L:)
    matvnqlvrkprarkvaksnvpaleacpqkrgvctrvytttpkkpnsalrkvcrvrltng
    fevtsyiggeghnlqehsvilirggrvkdlpgvryhtvrgaldcsgvkdrkqarskygvk
    rpka
    

    Sequence, based on observed residues (ATOM records):
    >4kjaL (L:)
    atvnqlvrkprarkvaksnvpaleacpqkrgvctrvytttpkkpnsalrkvcrvrltngf
    evtsyiggeghnlqehsvilirggrvkdlpgvryhtvrgaldcsgvkdrkqarskygvkr
    pka
    

  • Chain 'M':
    Sequence, based on SEQRES records:
    >4kjaM (M:)
    mariaginipdhkhavialtsiygvgktrskailaaagiaedvkiselsegqidtlrdev
    akfvvegdlrreismsikrlmdlgcyrglrhrrglpvrgqrtktnartrkgprkpikk
    

    Sequence, based on observed residues (ATOM records):
    >4kjaM (M:)
    ariaginipdhkhavialtsiygvgktrskailaaagiaedvkiselsegqidtlrdeva
    kfvvegdlrreismsikrlmdlgcyrglrhrrglpvrgqrtktnartrkgprkp
    

  • Chain 'N':
    Sequence, based on SEQRES records:
    >4kjaN (N:)
    makqsmkarevkrvaladkyfakraelkaiisdvnasdedrwnavlklqtlprdsspsrq
    rnrcrqtgrphgflrkfglsrikvreaamrgeipglkkasw
    

    Sequence, based on observed residues (ATOM records):
    >4kjaN (N:)
    akqsmkarevkrvaladkyfakraelkaiisdvnarwnavlklqtlprdsspsrqrnrcr
    qtgrphgflrkfglsrikvreaamrgeipglkkasw
    

  • Chain 'O':
    Sequence, based on SEQRES records:
    >4kjaO (O:)
    mslsteatakivsefgrdandtgstevqvalltaqinhlqghfaehkkdhhsrrgllrmv
    sqrrklldylkrkdvarytqlierlglrr
    

    Sequence, based on observed residues (ATOM records):
    >4kjaO (O:)
    slsteatakivsefgrdandtgstevqvalltaqinhlqghfaehkkdhhsrrgllrmvs
    qrrklldylkrkdvarytqlierlglrr
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records:
    >4kjaP (P:)
    mvtirlarhgakkrpfyqvvvadsrnarngrfiervgffnpiasekeegtrldldriahw
    vgqgatisdrvaalikevnkaa
    

  • Chain 'Q':
    Sequence, based on SEQRES records:
    >4kjaQ (Q:)
    mtdkirtlqgrvvsdkmeksivvaierfvkhpiygkfikrttklhvhdennecgigdvve
    irecrplsktkswtlvrvvekavl
    

    Sequence, based on observed residues (ATOM records):
    >4kjaQ (Q:)
    kirtlqgrvvsdkmeksivvaierfvkhpiygkfikrttklhvhdennecgigdvveire
    crplsktkswtlvrvvekav
    

  • Chain 'R':
    Sequence, based on SEQRES records:
    >4kjaR (R:)
    maryfrrrkfcrftaegvqeidykdiatlknyitesgkivpsritgtrakyqrqlaraik
    rarylsllpytdrhq
    

    Sequence, based on observed residues (ATOM records):
    >4kjaR (R:)
    eidykdiatlknyitesgkivpsritgtrakyqrqlaraikrarylsllpytdrh
    

  • Chain 'S':
    Sequence, based on SEQRES records:
    >4kjaS (S:)
    mprslkkgpfidlhllkkvekavesgdkkplrtwsrrstifpnmigltiavhngrqhvpv
    fvtdemvghklgefaptrtyrghaadkkakkk
    

    Sequence, based on observed residues (ATOM records):
    >4kjaS (S:)
    rslkkgpfidlhllkkvekavesgdkkplrtwsrrstifpnmigltiavhngrqhvpvfv
    tdemvghklgefaptrtyr
    

  • Chain 'T':
    Sequence, based on SEQRES records:
    >4kjaT (T:)
    maniksakkraiqsekarkhnasrrsmmrtfikkvyaaieagdkaaaqkafnemqpivdr
    qaakglihknkaarhkanltaqinkla
    

    Sequence, based on observed residues (ATOM records):
    >4kjaT (T:)
    niksakkraiqsekarkhnasrrsmmrtfikkvyaaieagdkaaaqkafnemqpivdrqa
    akglihknkaarhkanltaqinkla
    

  • Chain 'U':
    Sequence, based on SEQRES records:
    >4kjaU (U:)
    mpvikvrenepfdvalrrfkrscekagvlaevrrrefyekptterkrakasavkrhakkl
    arenarrtrly
    

    Sequence, based on observed residues (ATOM records):
    >4kjaU (U:)
    ikvrenepfdvalrrfkrscekagvlaevrrrefyekptterkrakasavk
    

  • Chain 'V':
    Sequence, based on SEQRES records:
    >4kjaV (V:)
    marttpiaryrnigisahidagktttterilfytgvnhkigevhdgaatmdwmeqeqerg
    ititsaattafwsgmakqyephriniidtpghvdftieversmrvldgavmvycavggvq
    pqsetvwrqankykvpriafvnkmdrmganflkvvnqiktrlganpvplqlaigaeehft
    gvvdlvkmkainwndadqgvtfeyedipadmvelanewhqnliesaaeaseelmekylgg
    eelteaeikgalrqrvlnneiilvtcgsafknkgvqamldavidylpspvdvpaingild
    dgkdtpaerhasddepfsalafkiatdpfvgnltffrvysgvvnsgdtvlnsvkaarerf
    grivqmhankreeikevragdiaaaiglkdvttgdtlcdpdapiilermefpepvisiav
    epktkadqekmglalgrlakedpsfrvwtdeesnqtiiagmgelhldiivdrmkrefnve
    anvgkpqvayretirqkvtdvegkhakqsggrgqyghvvidmyplepgsnpkgyefindi
    kggvipgeyipavdkgiqeqlkagplagypvvdmgirlhfgsyhdvdsselafklaasia
    fkegfkkakpvllepimkvevetpeentgdvigdlsrrrgmlkgqesevtgvkihaevpl
    semfgyatqlrsltkgrasytmeflkydeapsnvaqavieargk
    

    Sequence, based on observed residues (ATOM records):
    >4kjaV (V:)
    arttpiaryrnigisahidagktttterilfytgvnatmdwmeqeqergititsaattaf
    wsgmakqyephriniidtpghvdftieversmrvldgavmvycavggvqpqsetvwrqan
    kykvpriafvnkmdrmganflkvvnqiktrlganpvplqlaigaeehftgvvdlvkmkai
    nwndadqgvtfeyedipadmvelanewhqnliesaaeaseelmekylggeelteaeikga
    lrqrvlnneiilvtcgsafknkgvqamldavidylpspvdvpaingilddgkdtpaerha
    sddepfsalafkiatdpfvgnltffrvysgvvnsgdtvlnsvkaarerfgrivqmhankr
    eeikevragdiaaaiglkdvttgdtlcdpdapiilermefpepvisiavepktkadqekm
    glalgrlakedpsfrvwtdeesnqtiiagmgelhldiivdrmkrefnveanvgkpqvayr
    etirqkvtdvegkhakqsggrgqyghvvidmyplepgsnpkgyefindikggvipgeyip
    avdkgiqeqlkagplagypvvdmgirlhfgsyhdvdsselafklaasiafkegfkkakpv
    llepimkvevetpeentgdvigdlsrrrgmlkgqesevtgvkihaevplsemfgyatqlr
    sltkgrasytmeflkydeapsnvaqavie
    

  • Chain 'W':
    Sequence; same for both SEQRES and ATOM records:
    >4kjaW (W:)
    xassxx