SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.
You accessed the SCOPe website through a deprecated URL; see Help for SCOPe 2.01 for more info on linking to SCOPe.
Showing results for SCOPe 2.06; you can access the page in SCOP 1.75 here.

PDB entry 4KHQ

View 4KHQ on RCSB PDB site
Description: Ternary complex of RB69 mutant L415F wit DUMPNPP
Class: transferase/DNA
Keywords: nucleotide, transferase-DNA complex
Deposited on 2013-05-01, released 2013-10-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-10-30, with a file datestamp of 2013-10-25.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: 0.181
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase
    Species: Enterobacteria phage RB69 [TaxId:12353]
    Gene: 43
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q38087 (0-End)
      • engineered mutation (221)
      • engineered mutation (326)
      • engineered mutation (414)
    Domains in SCOPe 2.06: d4khqa1, d4khqa2
  • Chain 'P':
    Compound: DNA (5'-d(*gp*cp*gp*gp*ap*cp*tp*gp*cp*tp*tp*ap*cp*c)-3')
  • Chain 'T':
    Compound: DNA (5'-d(*ap*cp*ap*gp*gp*tp*ap*ap*gp*cp*ap*gp*tp*cp*cp*gp*cp*g)-3')
  • Heterogens: CA, DUP, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4khqA (A:)
    mkefyltveqigdsiferyidsngrertreveykpslfahcpesqatkyfdiygkpctrk
    lfanmrdasqwikrmediglealgmddfklaylsdtynyeikydhtkirvanfdievtsp
    dgfpepsqakhpidaithydsiddrfyvfdllnspygnveewsieiaaklqeqggdevps
    eiidkiiympfdnekellmeylnfwqqktpviltgwnvesfaipyvynriknifgestak
    rlsphrktrvkvienmygsreiitlfgisvldyidlykkfsftnqpsysldyisefelnv
    gklkydgpisklresnhqryisyniiavyrvlqidakrqfinlsldmgyyakiqiqsvfs
    piktwdaiifnslkeqnkvipqgrshpvqpypgafvkepipnrykyvmsfdltsfypsii
    rqvnispetiagtfkvaplhdyinavaerpsdvyscspngmmyykdrdgvvpteitkvfn
    qrkehkgymlaaqrngeiikealhnpnlsvdepldvdyrfdfsdeikekikklsakslne
    mlfraqrtevagmtaqinrkllinslygalgnvwfryydlrnataittfgqmalqwierk
    vneylnevcgtegeafvlygdtdsiyvsadkiidkvgeskfrdtnhwvdfldkfarerme
    paidrgfremceymnnkqhlmfmdreaiagpplgskgiggfwtgkkryalnvwdmegtry
    aepklkimgletqksstpkavqkalkecirrmlqegeeslqeyfkefekefrqlnyisia
    svssanniakydvggfpgpkcpfhirgiltynraikgnidapqvvegekvyvlplregnp
    fgdkciawpsgteitdlikddvlhwmdytvllektfikplegftsaakldyekkaslfdm
    fdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4khqA (A:)
    mkefyltveqigdsiferyidsngrertreveykpslfahcpesqatkyfdiygkpctrk
    lfanmrdasqwikrmediglealgmddfklaylsdtynyeikydhtkirvanfdievtsp
    dgfpepsqakhpidaithydsiddrfyvfdllnspygnveewsieiaaklqeqggdevps
    eiidkiiympfdnekellmeylnfwqqktpviltgwnvesfaipyvynriknifgestak
    rlsphrktrvkviensreiitlfgisvldyidlykkfsftnqpsysldyisefelnvgkl
    kydgpisklresnhqryisyniiavyrvlqidakrqfinlsldmgyyakiqiqsvfspik
    twdaiifnslkeqnkvipqgrshpvqpypgafvkepipnrykyvmsfdltsfypsiirqv
    nispetiagtfkvaplhdyinavaerpsdvyscspngmmyykdrdgvvpteitkvfnqrk
    ehkgymlaaqrngeiikealhnpnlsvdepldvdyrfdfsdeikekikklsakslnemlf
    raqrtevagmtaqinrkllinslygalgnvwfryydlrnataittfgqmalqwierkvne
    ylnevcgtegeafvlygdtdsiyvsadkiidkvgeskfrdtnhwvdfldkfarermepai
    drgfremceymnnkqhlmfmdreaiagpplgskgiggfwtgkkryalnvwdmegtryaep
    klkimgletqksstpkavqkalkecirrmlqegeeslqeyfkefekefrqlnyisiasvs
    sanniakydvggfpgpkcpfhirgiltynraikgnidapqvvegekvyvlplregnpfgd
    kciawpsgteitdlikddvlhwmdytvllektfikplegftsaakldyekkaslfdmfd
    

  • Chain 'P':
    No sequence available.

  • Chain 'T':
    No sequence available.