You accessed the SCOPe website through a deprecated URL; see Help for SCOPe 2.01 for more info on linking to SCOPe.
Showing results for SCOPe 2.06; you can access the page in SCOP 1.75 here.

PDB entry 4KHQ

View 4KHQ on RCSB PDB site
Description: Ternary complex of RB69 mutant L415F wit DUMPNPP
Class: transferase/DNA
Keywords: nucleotide, transferase-DNA complex
Deposited on 2013-05-01, released 2013-10-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-10-30, with a file datestamp of 2013-10-25.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: 0.181
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase
    Species: Enterobacteria phage RB69 [TaxId:12353]
    Gene: 43
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q38087 (0-End)
      • engineered mutation (221)
      • engineered mutation (326)
      • engineered mutation (414)
    Domains in SCOPe 2.06: d4khqa1, d4khqa2
  • Chain 'P':
    Compound: DNA (5'-d(*gp*cp*gp*gp*ap*cp*tp*gp*cp*tp*tp*ap*cp*c)-3')
  • Chain 'T':
    Compound: DNA (5'-d(*ap*cp*ap*gp*gp*tp*ap*ap*gp*cp*ap*gp*tp*cp*cp*gp*cp*g)-3')
  • Heterogens: CA, DUP, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4khqA (A:)
    mkefyltveqigdsiferyidsngrertreveykpslfahcpesqatkyfdiygkpctrk
    lfanmrdasqwikrmediglealgmddfklaylsdtynyeikydhtkirvanfdievtsp
    dgfpepsqakhpidaithydsiddrfyvfdllnspygnveewsieiaaklqeqggdevps
    eiidkiiympfdnekellmeylnfwqqktpviltgwnvesfaipyvynriknifgestak
    rlsphrktrvkvienmygsreiitlfgisvldyidlykkfsftnqpsysldyisefelnv
    gklkydgpisklresnhqryisyniiavyrvlqidakrqfinlsldmgyyakiqiqsvfs
    piktwdaiifnslkeqnkvipqgrshpvqpypgafvkepipnrykyvmsfdltsfypsii
    rqvnispetiagtfkvaplhdyinavaerpsdvyscspngmmyykdrdgvvpteitkvfn
    qrkehkgymlaaqrngeiikealhnpnlsvdepldvdyrfdfsdeikekikklsakslne
    mlfraqrtevagmtaqinrkllinslygalgnvwfryydlrnataittfgqmalqwierk
    vneylnevcgtegeafvlygdtdsiyvsadkiidkvgeskfrdtnhwvdfldkfarerme
    paidrgfremceymnnkqhlmfmdreaiagpplgskgiggfwtgkkryalnvwdmegtry
    aepklkimgletqksstpkavqkalkecirrmlqegeeslqeyfkefekefrqlnyisia
    svssanniakydvggfpgpkcpfhirgiltynraikgnidapqvvegekvyvlplregnp
    fgdkciawpsgteitdlikddvlhwmdytvllektfikplegftsaakldyekkaslfdm
    fdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4khqA (A:)
    mkefyltveqigdsiferyidsngrertreveykpslfahcpesqatkyfdiygkpctrk
    lfanmrdasqwikrmediglealgmddfklaylsdtynyeikydhtkirvanfdievtsp
    dgfpepsqakhpidaithydsiddrfyvfdllnspygnveewsieiaaklqeqggdevps
    eiidkiiympfdnekellmeylnfwqqktpviltgwnvesfaipyvynriknifgestak
    rlsphrktrvkviensreiitlfgisvldyidlykkfsftnqpsysldyisefelnvgkl
    kydgpisklresnhqryisyniiavyrvlqidakrqfinlsldmgyyakiqiqsvfspik
    twdaiifnslkeqnkvipqgrshpvqpypgafvkepipnrykyvmsfdltsfypsiirqv
    nispetiagtfkvaplhdyinavaerpsdvyscspngmmyykdrdgvvpteitkvfnqrk
    ehkgymlaaqrngeiikealhnpnlsvdepldvdyrfdfsdeikekikklsakslnemlf
    raqrtevagmtaqinrkllinslygalgnvwfryydlrnataittfgqmalqwierkvne
    ylnevcgtegeafvlygdtdsiyvsadkiidkvgeskfrdtnhwvdfldkfarermepai
    drgfremceymnnkqhlmfmdreaiagpplgskgiggfwtgkkryalnvwdmegtryaep
    klkimgletqksstpkavqkalkecirrmlqegeeslqeyfkefekefrqlnyisiasvs
    sanniakydvggfpgpkcpfhirgiltynraikgnidapqvvegekvyvlplregnpfgd
    kciawpsgteitdlikddvlhwmdytvllektfikplegftsaakldyekkaslfdmfd
    

  • Chain 'P':
    No sequence available.

  • Chain 'T':
    No sequence available.