You accessed the SCOPe website through a deprecated URL; see Help for SCOPe 2.01 for more info on linking to SCOPe.
Showing results for SCOPe 2.06; you can access the page in SCOP 1.75 here.

PDB entry 4K98

View 4K98 on RCSB PDB site
Description: Structure of Ternary Complex of cGAS with dsDNA and Bound 5 -pppG(2 ,5 )pG
Deposited on 2013-04-19, released 2013-05-15
The last revision was dated 2013-08-28, with a file datestamp of 2013-08-23.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.159
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cyclic GMP-AMP synthase
    Species: Mus musculus [TaxId:10090]
    Gene: Mb21d1
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: DNA-f
    Species: synthetic, synthetic
  • Chain 'E':
    Compound: DNA-r
    Species: synthetic, synthetic
  • Heterogens: ZN, MG, GTP, G, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.06, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >4k98A (A:)
    spdklkkvldklrlkrkdiseaaetvnkvverllrrmqkresefkgveqlntgsyyehvk
    isapnefdvmfklevprielqeyyetgafylvkfkriprgnplshflegevlsatkmlsk
    frkiikeevkeikdidvsvekekpgspavtllirnpeeisvdiilaleskgswpistkeg
    lpiqgwlgtkvrtnlrrepfylvpknakdgnsfqgetwrlsfshtekyilnnhgiektcc
    essgakccrkeclklmkylleqlkkefqeldafcsyhvktaifhmwtqdpqdsqwdprnl
    sscfdkllaffleclrtekldhyfipkfnlfsqelidrkskeflskkieyernngfpifd
    kl
    

    Sequence, based on observed residues (ATOM records):
    >4k98A (A:)
    klkkvldklrlkrkdiseaaetvnkvverllrrmqkresefkgveqlntgsyyehvkisa
    pnefdvmfklevprielqeyyetgafylvkfkgnplshflegevlsatkmlskfrkiike
    evkeikdidvsvekekpgspavtllirnpeeisvdiilaleskgswpistkeglpiqgwl
    gtkvrtnlrrepfylvpknakdgnsfqgetwrlsfshtekyilnnhgiektccessgakc
    crkeclklmkylleqlkkefqeldafcsyhvktaifhmwtqdpqdsqwdprnlsscfdkl
    laffleclrtekldhyfipkfnlfsqelidrkskeflskkieyernngfpifdk
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.