You accessed the SCOPe website through a deprecated URL; see Help for SCOPe 2.01 for more info on linking to SCOPe.
Showing results for SCOPe 2.06; you can access the page in SCOP 1.75 here.

PDB entry 4K0M

View 4K0M on RCSB PDB site
Description: Crystal structure of Thermus thermophilus 70S containing tRNAs and mRNA stop codon with pseudouridine
Deposited on 2013-04-04, released 2013-07-03
The last revision was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.228
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '0':
    Compound: 50S ribosomal protein L27
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain '1':
    Compound: 50S ribosomal protein L28
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60494 (0-92)
      • conflict (78)
  • Chain '2':
    Compound: 50S ribosomal protein L29
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain '3':
    Compound: 50S ribosomal protein L30
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain '4':
    Compound: 50S ribosomal protein L31
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain '5':
    Compound: 50S ribosomal protein L32
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain '6':
    Compound: 50S ribosomal protein L33
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain '7':
    Compound: 50S ribosomal protein L34
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain '8':
    Compound: 50S ribosomal protein L35
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain '9':
    Compound: 50S ribosomal protein L36
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'A':
    Compound: 23S ribosomal RNA
    Species: Thermus thermophilus [TaxId:300852]
  • Chain 'B':
    Compound: 5S ribosomal RNA
    Species: Thermus thermophilus [TaxId:300852]
  • Chain 'C':
    Compound: 50s ribosomal protein l1
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • PDB 4K0M (0-205)
  • Chain 'D':
    Compound: 50S ribosomal protein L2
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: 50S ribosomal protein L3
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: 50S ribosomal protein L4
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: 50S ribosomal protein L5
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: 50S ribosomal protein L6
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: 50S ribosomal protein L9
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: 50s ribosomal protein l10
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • PDB 4K0M (0-129)
  • Chain 'N':
    Compound: 50S ribosomal protein L13
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: 50S ribosomal protein L14
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'P':
    Compound: 50S ribosomal protein L15
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: 50S ribosomal protein L16
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'R':
    Compound: 50S ribosomal protein L17
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'S':
    Compound: 50S ribosomal protein L18
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'T':
    Compound: 50S ribosomal protein L19
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'U':
    Compound: 50S ribosomal protein L20
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60491 (0-116)
      • conflict (30)
  • Chain 'V':
    Compound: 50S ribosomal protein L21
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'W':
    Compound: 50S ribosomal protein L22
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SHP3 (0-112)
      • conflict (112)
  • Chain 'X':
    Compound: 50S ribosomal protein L23
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Y':
    Compound: 50S ribosomal protein L24
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Z':
    Compound: 50S ribosomal protein L25
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.06, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain '0':
    Sequence; same for both SEQRES and ATOM records:
    >4k0m0 (0:)
    ahkkglgstrngrdsqakrlgvkryegqvvragnilvrqrgtrfkpgknvgmgrdftlfa
    lvdgvvefqdrgrlgryvhvrpla
    

  • Chain '1':
    Sequence; same for both SEQRES and ATOM records:
    >4k0m1 (1:)
    kvceisgkrpivansiqrrgkakreggvgkkttgiskrrqypnlqkvrvrvagqeitfrv
    aashipkvyelverakglrleglspkeikkell
    

  • Chain '2':
    Sequence; same for both SEQRES and ATOM records:
    >4k0m2 (2:)
    klsevrkqleearklspveleklvrekkrelmelrfqasigqlsqnhkirdlkrqiarll
    tvlnekrrqna
    

  • Chain '3':
    Sequence; same for both SEQRES and ATOM records:
    >4k0m3 (3:)
    mprlkvklvkspigypkdqkaalkalglrrlqqervledtpairgnvekvahlvrvevv
    

  • Chain '4':
    Sequence; same for both SEQRES and ATOM records:
    >4k0m4 (4:)
    vpariicgcgnvietystkpeiyvevcskc
    

  • Chain '5':
    Sequence; same for both SEQRES and ATOM records:
    >4k0m5 (5:)
    akhpvpkkktskarrdarrshhaltpptlvpcpeckamkpphtvcpecgyyagrkvlev
    

  • Chain '6':
    Sequence; same for both SEQRES and ATOM records:
    >4k0m6 (6:)
    lllecteckrrnyateknkrntpnklelrkycpwcrkhtvhrev
    

  • Chain '7':
    Sequence; same for both SEQRES and ATOM records:
    >4k0m7 (7:)
    mkrtwqpnrrkrakthgfrarmrtpggrkvlkrrrqkgrwrltpavrk
    

  • Chain '8':
    Sequence; same for both SEQRES and ATOM records:
    >4k0m8 (8:)
    pkmkthkgakkrvkitasgkvvamktgkrhlnwqksgkeirqkgrkfvlakpeaerikll
    lpy
    

  • Chain '9':
    Sequence; same for both SEQRES and ATOM records:
    >4k0m9 (9:)
    kvrasvkricdkckvirrhgrvyvicenpkhkqrqg
    

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records:
    >4k0mC (C:)
    kvytideaarlvkelatakfdetvevhaklgidprrsdqnvrgtvslphglgkqvrvlai
    akgekikeaeeagadyvggeeiiqaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
    aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
    aaaaaaaaaaaaaaaaaaaaaaaaaa
    

    Sequence, based on observed residues (ATOM records):
    >4k0mC (C:)
    kvytideaartakfdetvevhaklgidprrsdqnvrgtvslphglgkqvrvlaiakgeki
    keaeeagadyvggeeiiqaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
    aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
    aaaaaaaaaa
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >4k0mD (D:)
    avkkfkpytpsrrfmtvadfseitktepekslvkplkktggrnnqgritvrfrggghkrl
    yriidfkrwdkvgipakvaaieydpnrsariallhyvdgekryiiapdglqvgqqvvagp
    dapiqvgnalplrfipvgtvvhavelepkkgaklaraagtsaqiqgregdyvilrlpsge
    lrkvhgecyatvgavgnadhknivlgkagrsrwlgrrphvrgaamnpvdhphgggegrap
    rgrppaspwgwqtkglktrkrrkpssrfiia
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records:
    >4k0mE (E:)
    mkgilgvkvgmtrifrddravpvtvilagpcpvvqrrtpekdgytavqlgflpqnpkrvn
    rplkghfakagvepvrilreirdfnpegdtvtveifkpgervdvtgtskgrgfagvmkrw
    nfaggpdshgahkihrhpgsignrktpgrvykgkkmaghygaervtvmnlevvdvipeen
    lllvkgavpgpngglvivretkka
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records:
    >4k0mF (F:)
    mkevavyqipvlspsgrrelaadlpaeinphllwevvrwqlakrrrgtastktrgevays
    grkiwpqkhtgrarhgdigapifvgggvvfgpkprdysytlpkkvrkkglamavadrare
    gklllveafagvngktkeflawakeagldgsesvllvtgnelvrraarnlpwvvtlapeg
    lnvydivrterlvmdldawevfqnrig
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records:
    >4k0mG (G:)
    pldvalkrkyyeevrpelirrfgyqnvwevprlekvvinqglgeakedarilekaaqela
    litgqkpavtrakksisnfklrkgmpiglrvtlrrdrmwiflekllnvalprirdfrgln
    pnsfdgrgnynlglreqlifpeitydmvdalrgmdiavvttaetdeearallellgfpfr
    k
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records:
    >4k0mH (H:)
    pkgvsvevapgrvkvkgpkgelevpvspemrvvveegvvrverpsderrhkslhgltrtl
    ianavkgvsegyskellikgigyrarlvgraleltvgfshpvvveppegitfevpeptrv
    rvsgidkqkvgqvaanirairkpsayhekgiyyagepvr
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records:
    >4k0mI (I:)
    mkvilleplenlgdvgqvvdvkpgyarnyllprglavlatesnlkaleariraqakrlae
    rkaeaerlkeilenltltipvragetkiygsvtakdiaealsrqhgvtidpkrlalekpi
    kelgeyvltykphpevpiqlkvsvv
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records:
    >4k0mJ (J:)
    aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
    aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
    aaaaaaaaaa
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records:
    >4k0mN (N:)
    mktyvpkqveprwvlidaegktlgrlatkiatllrgkhrpdwtpnvamgdfvvvvnadki
    rvtgkkleqkiytrysgypgglkkiplekmlathpervlehavkgmlpkgplgrrlfkrl
    kvyagpdhphqaqrpekl
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records:
    >4k0mO (O:)
    miqpqtylevadntgarkimcirvlkgsnakyatvgdvivasvkeaiprgavkegdvvka
    vvvrtkkeikrpdgsairfddnaaviinnqleprgtrvfgpvarelrekgfmkivslape
    vl
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records:
    >4k0mP (P:)
    dlrpnpgankrrkrvgrgpgsghgktatrghkgqksrsgglkdprrfeggrsttlmrlpk
    rgmqgqvpgeikrpryqgvnlkdlarfegevtpellvragllkkgyrlkilgegeakplk
    vvahafsksaleklkaaggepvllea
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records:
    >4k0mQ (Q:)
    mlmprrmkyrkqqrgrlkgatkggdyvafgdyglvalepawitaqqieaarvamvrhfrr
    ggkifirifpdkpytkkplevrmgkgkgnvegyvavvkpgrvmfevagvteeqamealri
    aghklpiktkivrrdaydeaq
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records:
    >4k0mR (R:)
    rhlksgrklnrhsshrlalyrnqaksllthgritttvpkakelrgfvdhlihlakrgdlh
    arrlvlrdlqdvklvrklfdeiapryrdrqggytrvlklaerrrgdgaplalvelve
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records:
    >4k0mS (S:)
    kfrvrnrikrtgrlrlsvfrslkhiyaqiiddekgvtlvsasslalklkgnktevarqvg
    ralaekalalgikqvafdrgpykyhgrvkalaegareg
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records:
    >4k0mT (T:)
    mnrgaliklvesryvrtdlpefrpgdtvrvsykvkegnrtriqdfegivirirrngfntt
    ftvrkvsygvgverifplhspliqkidivqrgrarraklyfirnlsdreirrklradrkr
    idqdraaeraakeeaqk
    

  • Chain 'U':
    Sequence; same for both SEQRES and ATOM records:
    >4k0mU (U:)
    praktgvvrrrkhkkilklakgywglrsksarkaretlfaagnyayahrkrrkrdfrrlw
    ivrinaacrqhglnystfihglkkagievdrknladlavrepqvfaelverakaaqg
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records:
    >4k0mV (V:)
    mfaivktggkqyrvepglklrvekldaepgatvelpvlllggektvvgtpvvegasvvae
    vlghgrgkkilvskfkakvqyrrkkghrqpytellikeirg
    

  • Chain 'W':
    Sequence; same for both SEQRES and ATOM records:
    >4k0mW (W:)
    meakaiaryvrisprkvrlvvdlirgksleearnilrytnkrgayfvakvlesaaanavn
    nhdmledrlyvkaayvdegpalkrvlprargradiikkrtshitvilgekhga
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records:
    >4k0mX (X:)
    taydvilapvlsekayagfaegkytfwvhpkatkteiknavetafkvkvvkvntlhvrgk
    kkrlgrylgkrpdrkkaivqvapgqkiealeg
    

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records:
    >4k0mY (Y:)
    rvkmhvkkgdtvlvasgkykgrvgkvkevlpkkyavivegvnivkkavrvspkypqggfi
    ekeaplhaskvrpicpacgkptrvrkkflengkkirvcak
    

  • Chain 'Z':
    Sequence; same for both SEQRES and ATOM records:
    >4k0mZ (Z:)
    yrlkayyregekpsalrragklpgvmynrhlnrkvyvdlvefdkvfrqasihhvivlelp
    dgqslptlvrqvnldkrrrrpehvdffvlsdepvemyvplrfvgtpagvraggvlqeihr
    dilvkvsprnipefievdvsgleigdslhasdlklppgvelavspeetiaavvppe