You accessed the SCOPe website through a deprecated URL; see Help for SCOPe 2.01 for more info on linking to SCOPe.
Showing results for SCOPe 2.06; you can access the page in SCOP 1.75 here.

PDB entry 4JGC

View 4JGC on RCSB PDB site
Description: human tdg n140a mutant in a complex with 5-carboxylcytosine (5cac)
Deposited on 2013-02-28, released 2013-05-29
The last revision was dated 2013-07-03, with a file datestamp of 2013-06-28.
Experiment type: XRAY
Resolution: 2.58 Å
R-factor: 0.232
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: G/T mismatch-specific thymine DNA glycosylase
    Species: Homo sapiens [TaxId:9606]
    Gene: TDG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13569 (6-End)
      • expression tag (5)
      • engineered mutation (35)
  • Chain 'C':
    Compound: oligonucleotide
    Species: synthetic, synthetic
  • Chain 'D':
    Compound: oligonucleotide containing 5-carboxylcytosine
    Species: synthetic, synthetic
  • Heterogens: 1RT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.06, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >4jgcA (A:)
    gshmasfngvseaelltktlpdiltfnldiviigiapglmaaykghhypgpgnhfwkclf
    msglsevqlnhmddhtlpgkygigftnmverttpgskdlsskefreggrilvqklqkyqp
    riavfngkciyeifskevfgvkvknlefglqphkipdtetlcyvmpsssarcaqfpraqd
    kvhyyiklkdlrdqlkgiernmdv
    

    Sequence, based on observed residues (ATOM records):
    >4jgcA (A:)
    sfngvseaelltktlpdiltfnldiviigiapglmaaykghhypgpgnhfwkclfmsgls
    evqlnhmddhtlpgkygigftnmverttpgskdlsskefreggrilvqklqkyqpriavf
    ngkciyeifskevfgvkvknlefglqphkipdtetlcyvmpsssarcaqfpraqdkvhyy
    iklkdlrdqlkgiern
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.