You accessed the SCOPe website through a deprecated URL; see Help for SCOPe 2.01 for more info on linking to SCOPe.
Showing results for SCOPe 2.06; you can access the page in SCOP 1.75 here.

PDB entry 4J2A

View 4J2A on RCSB PDB site
Description: RB69 DNA Polymerase L415A Ternary Complex
Class: Transferase/DNA
Keywords: RB69, DNA polymerase, L415A, polymerase, Transferase-DNA complex
Deposited on 2013-02-04, released 2014-02-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-02-19, with a file datestamp of 2014-02-14.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.18
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase
    Species: Enterobacteria phage RB69 [TaxId:12353]
    Gene: 43
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q38087 (0-900)
      • engineered mutation (221)
      • engineered mutation (326)
      • engineered mutation (414)
    Domains in SCOPe 2.06: d4j2aa1, d4j2aa2
  • Chain 'P':
    Compound: DNA (5'-d(*gp*cp*gp*gp*ap*cp*tp*gp*cp*tp*tp*ap*c)-3')
  • Chain 'T':
    Compound: DNA (5'-d(*tp*cp*gp*ap*gp*tp*ap*ap*gp*cp*ap*gp*tp*cp*cp*gp*cp*g)-3')
  • Heterogens: TTP, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4j2aA (A:)
    mkefyltveqigdsiferyidsngrertreveykpslfahcpesqatkyfdiygkpctrk
    lfanmrdasqwikrmediglealgmddfklaylsdtynyeikydhtkirvanfdievtsp
    dgfpepsqakhpidaithydsiddrfyvfdllnspygnveewsieiaaklqeqggdevps
    eiidkiiympfdnekellmeylnfwqqktpviltgwnvesfaipyvynriknifgestak
    rlsphrktrvkvienmygsreiitlfgisvldyidlykkfsftnqpsysldyisefelnv
    gklkydgpisklresnhqryisyniiavyrvlqidakrqfinlsldmgyyakiqiqsvfs
    piktwdaiifnslkeqnkvipqgrshpvqpypgafvkepipnrykyvmsfdltsaypsii
    rqvnispetiagtfkvaplhdyinavaerpsdvyscspngmmyykdrdgvvpteitkvfn
    qrkehkgymlaaqrngeiikealhnpnlsvdepldvdyrfdfsdeikekikklsakslne
    mlfraqrtevagmtaqinrkllinslygalgnvwfryydlrnataittfgqmalqwierk
    vneylnevcgtegeafvlygdtdsiyvsadkiidkvgeskfrdtnhwvdfldkfarerme
    paidrgfremceymnnkqhlmfmdreaiagpplgskgiggfwtgkkryalnvwdmegtry
    aepklkimgletqksstpkavqkalkecirrmlqegeeslqeyfkefekefrqlnyisia
    svssanniakydvggfpgpkcpfhirgiltynraikgnidapqvvegekvyvlplregnp
    fgdkciawpsgteitdlikddvlhwmdytvllektfikplegftsaakldyekkaslfdm
    f
    

  • Chain 'P':
    No sequence available.

  • Chain 'T':
    No sequence available.