You accessed the SCOPe website through a deprecated URL; see Help for SCOPe 2.01 for more info on linking to SCOPe.
Showing results for SCOPe 2.06; you can access the page in SCOP 1.75 here.

PDB entry 4IDX

View 4IDX on RCSB PDB site
Description: hexameric crystal structure of Schmallenberg virus nucleoprotein
Deposited on 2012-12-13, released 2013-04-24
The last revision was dated 2013-10-02, with a file datestamp of 2013-09-27.
Experiment type: XRAY
Resolution: 3.21 Å
R-factor: 0.324
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nucleocapsid protein
    Species: Schmallenberg virus [TaxId:1133363]
    Gene: N
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: nucleocapsid protein
    Species: Schmallenberg virus [TaxId:1133363]
    Gene: N
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: nucleocapsid protein
    Species: Schmallenberg virus [TaxId:1133363]
    Gene: N
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.06, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >4idxA (A:)
    mssqfifedvpqrnaatfnpevgyvafigkygqqlnfgvarvfflnqkkakmvlhktaqp
    svdltfggvkftvvnnhfpqyvsnpvpdnaitlhrmsgylarwiadtckasvlklaeasa
    qivmplaevkgctwadgytmylgfapgaemfldafdfyplviemhrvlkdnmdvnfmkkv
    lrqrygtmtaeewmtqkiteikaafnsvgqlawaksgfspaartflqqfgini
    

    Sequence, based on observed residues (ATOM records):
    >4idxA (A:)
    pqrnaatfnpevgyvafigkygqqlnfgvarvfflnqkkakmvlhktaqpsvdltfggvk
    ftvvnnhfpqyvsnpvpdnaitlhrmsgylarwiadtckasvlklaeasaqivmplaevk
    gctwadgytmylgfapgaemfldafdfyplviemhrvlkdnmdvnfmkkvlrqrygtmta
    eewmtqkiteikaafnsvgqlawaksgfspaartflqq
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >4idxB (B:)
    mssqfifedvpqrnaatfnpevgyvafigkygqqlnfgvarvfflnqkkakmvlhktaqp
    svdltfggvkftvvnnhfpqyvsnpvpdnaitlhrmsgylarwiadtckasvlklaeasa
    qivmplaevkgctwadgytmylgfapgaemfldafdfyplviemhrvlkdnmdvnfmkkv
    lrqrygtmtaeewmtqkiteikaafnsvgqlawaksgfspaartflqqfgini
    

    Sequence, based on observed residues (ATOM records):
    >4idxB (B:)
    tfnpevgyvafigkygqqlnfgvarvfflnqkkakmvlhktaqpsvdltfggvkftvvnn
    hfpqyvsnpvpdnaitlhrmsgylarwiadtckasvlklaeasaqivmplaevkgctwad
    gytmylgfapgaemfldafdfyplviemhrvlkdnmdvnfmkkvlrqrygtmtaeewmtq
    kiteikaafnsvgqlawaksgfspaartf
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >4idxC (C:)
    mssqfifedvpqrnaatfnpevgyvafigkygqqlnfgvarvfflnqkkakmvlhktaqp
    svdltfggvkftvvnnhfpqyvsnpvpdnaitlhrmsgylarwiadtckasvlklaeasa
    qivmplaevkgctwadgytmylgfapgaemfldafdfyplviemhrvlkdnmdvnfmkkv
    lrqrygtmtaeewmtqkiteikaafnsvgqlawaksgfspaartflqqfgini
    

    Sequence, based on observed residues (ATOM records):
    >4idxC (C:)
    atfnpevgyvafigkygqqlnfgvarvfflnqkkakmvlhktaqpsvdltfggvkftvvn
    nhfpqyvsnpvpdnaitlhrmsgylarwiadtckasvlklaeasaqivmplaevkgctwa
    dgytmylgfapgaemfldafdfyplviemhrvlkdnmdvnfmkkvlrqrygtmtaeewmt
    qkiteikaafnsvgqlawaksgfspaartflqq