SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.
You accessed the SCOPe website through a deprecated URL; see Help for SCOPe 2.01 for more info on linking to SCOPe.
Showing results for SCOPe 2.06; you can access the page in SCOP 1.75 here.

PDB entry 4IDX

View 4IDX on RCSB PDB site
Description: hexameric crystal structure of Schmallenberg virus nucleoprotein
Deposited on 2012-12-13, released 2013-04-24
The last revision was dated 2013-10-02, with a file datestamp of 2013-09-27.
Experiment type: XRAY
Resolution: 3.21 Å
R-factor: 0.324
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nucleocapsid protein
    Species: Schmallenberg virus [TaxId:1133363]
    Gene: N
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: nucleocapsid protein
    Species: Schmallenberg virus [TaxId:1133363]
    Gene: N
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: nucleocapsid protein
    Species: Schmallenberg virus [TaxId:1133363]
    Gene: N
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.06, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >4idxA (A:)
    mssqfifedvpqrnaatfnpevgyvafigkygqqlnfgvarvfflnqkkakmvlhktaqp
    svdltfggvkftvvnnhfpqyvsnpvpdnaitlhrmsgylarwiadtckasvlklaeasa
    qivmplaevkgctwadgytmylgfapgaemfldafdfyplviemhrvlkdnmdvnfmkkv
    lrqrygtmtaeewmtqkiteikaafnsvgqlawaksgfspaartflqqfgini
    

    Sequence, based on observed residues (ATOM records):
    >4idxA (A:)
    pqrnaatfnpevgyvafigkygqqlnfgvarvfflnqkkakmvlhktaqpsvdltfggvk
    ftvvnnhfpqyvsnpvpdnaitlhrmsgylarwiadtckasvlklaeasaqivmplaevk
    gctwadgytmylgfapgaemfldafdfyplviemhrvlkdnmdvnfmkkvlrqrygtmta
    eewmtqkiteikaafnsvgqlawaksgfspaartflqq
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >4idxB (B:)
    mssqfifedvpqrnaatfnpevgyvafigkygqqlnfgvarvfflnqkkakmvlhktaqp
    svdltfggvkftvvnnhfpqyvsnpvpdnaitlhrmsgylarwiadtckasvlklaeasa
    qivmplaevkgctwadgytmylgfapgaemfldafdfyplviemhrvlkdnmdvnfmkkv
    lrqrygtmtaeewmtqkiteikaafnsvgqlawaksgfspaartflqqfgini
    

    Sequence, based on observed residues (ATOM records):
    >4idxB (B:)
    tfnpevgyvafigkygqqlnfgvarvfflnqkkakmvlhktaqpsvdltfggvkftvvnn
    hfpqyvsnpvpdnaitlhrmsgylarwiadtckasvlklaeasaqivmplaevkgctwad
    gytmylgfapgaemfldafdfyplviemhrvlkdnmdvnfmkkvlrqrygtmtaeewmtq
    kiteikaafnsvgqlawaksgfspaartf
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >4idxC (C:)
    mssqfifedvpqrnaatfnpevgyvafigkygqqlnfgvarvfflnqkkakmvlhktaqp
    svdltfggvkftvvnnhfpqyvsnpvpdnaitlhrmsgylarwiadtckasvlklaeasa
    qivmplaevkgctwadgytmylgfapgaemfldafdfyplviemhrvlkdnmdvnfmkkv
    lrqrygtmtaeewmtqkiteikaafnsvgqlawaksgfspaartflqqfgini
    

    Sequence, based on observed residues (ATOM records):
    >4idxC (C:)
    atfnpevgyvafigkygqqlnfgvarvfflnqkkakmvlhktaqpsvdltfggvkftvvn
    nhfpqyvsnpvpdnaitlhrmsgylarwiadtckasvlklaeasaqivmplaevkgctwa
    dgytmylgfapgaemfldafdfyplviemhrvlkdnmdvnfmkkvlrqrygtmtaeewmt
    qkiteikaafnsvgqlawaksgfspaartflqq