SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.
You accessed the SCOPe website through a deprecated URL; see Help for SCOPe 2.01 for more info on linking to SCOPe.
Showing results for SCOPe 2.06; you can access the page in SCOP 1.75 here.

PDB entry 4I9Q

View 4I9Q on RCSB PDB site
Description: Crystal structure of the ternary complex of the D714A mutant of RB69 DNA polymerase
Deposited on 2012-12-05, released 2013-10-09
The last revision was dated 2013-10-23, with a file datestamp of 2013-10-18.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.254
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase
    Species: Enterobacteria phage RB69 [TaxId:12353]
    Gene: 43
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q38087 (0-End)
      • engineered mutation (221)
      • engineered mutation (326)
      • engineered mutation (566)
      • engineered mutation (713)
  • Chain 'B':
    Compound: DNA polymerase
    Species: Enterobacteria phage RB69 [TaxId:12353]
    Gene: 43
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q38087 (0-End)
      • engineered mutation (221)
      • engineered mutation (326)
      • engineered mutation (566)
      • engineered mutation (713)
  • Chain 'C':
    Compound: DNA (5'-d(*gp*cp*gp*gp*ap*cp*tp*gp*cp*tp*tp*ap*c)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'D':
    Compound: DNA (5'-d(*tp*cp*ap*cp*gp*tp*ap*ap*gp*cp*ap*gp*tp*cp*cp*gp*cp*g)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'P':
    Compound: DNA (5'-d(*gp*cp*gp*gp*ap*cp*tp*gp*cp*tp*tp*ap*c)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'T':
    Compound: DNA (5'-d(*tp*cp*ap*cp*gp*tp*ap*ap*gp*cp*ap*gp*tp*cp*cp*gp*cp*g)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Heterogens: XG4, CA, NA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.06, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >4i9qA (A:)
    mkefyltveqigdsiferyidsngrertreveykpslfahcpesqatkyfdiygkpctrk
    lfanmrdasqwikrmediglealgmddfklaylsdtynyeikydhtkirvanfdievtsp
    dgfpepsqakhpidaithydsiddrfyvfdllnspygnveewsieiaaklqeqggdevps
    eiidkiiympfdnekellmeylnfwqqktpviltgwnvesfaipyvynriknifgestak
    rlsphrktrvkvienmygsreiitlfgisvldyidlykkfsftnqpsysldyisefelnv
    gklkydgpisklresnhqryisyniiavyrvlqidakrqfinlsldmgyyakiqiqsvfs
    piktwdaiifnslkeqnkvipqgrshpvqpypgafvkepipnrykyvmsfdltslypsii
    rqvnispetiagtfkvaplhdyinavaerpsdvyscspngmmyykdrdgvvpteitkvfn
    qrkehkgymlaaqrngeiikealhnpnlsvdepldvdyrfdfsdeikekikklsakslne
    mlfraqrtevagmtaqinrkllinslagalgnvwfryydlrnataittfgqmalqwierk
    vneylnevcgtegeafvlygdtdsiyvsadkiidkvgeskfrdtnhwvdfldkfarerme
    paidrgfremceymnnkqhlmfmdreaiagpplgskgiggfwtgkkryalnvwamegtry
    aepklkimgletqksstpkavqkalkecirrmlqegeeslqeyfkefekefrqlnyisia
    svssanniakydvggfpgpkcpfhirgiltynraikgnidapqvvegekvyvlplregnp
    fgdkciawpsgteitdlikddvlhwmdytvllektfikplegftsaakldyekkaslfdm
    fdf
    

    Sequence, based on observed residues (ATOM records):
    >4i9qA (A:)
    mkefyltveqigdsiferyidsngrertreveykpslfahcpesqatkyfdiygkpctrk
    lfanmrdasqwikrmediglealgmddfklaylsdtynyeikydhtkirvanfdievtsp
    dgfpepsqakhpidaithydsiddrfyvfdllnspygnveewsieiaaklqeqggdevps
    eiidkiiympfdnekellmeylnfwqqktpviltgwnvesfaipyvynriknifgestak
    rlsphrktrvkvienmygsreiitlfgisvldyidlykkfsftnqpsysldyisefelnv
    gklkydgpisklresnhqryisyniiavyrvlqidakrqfinlsldmgyyakiqiqsvfs
    piktwdaiifnslkeqnkvipqgrshpvqpypgafvkepipnrykyvmsfdltslypsii
    rqvnispetiagtfkvaplhdyinavaerpsdvyscspngmmyykdrdgvvpteitkvfn
    qrkehkgymlaaqrngqrtevagmtaqinrkllinslagalgnvwfryydlrnataittf
    gqmalqwierkvneylnevcgtegeafvlygdtdsiyvsadkiidkvgeskfrdtnhwvd
    fldkfarermepaidrgfremceymnnkqhlmfmdreaiagpplgskgiggfwtgkkrya
    lnvwamegtryaepklkimgletqksstpkavqkalkecirrmlqegeeslqeyfkefek
    efrqlnyisiasvssanniakydvggfpgpkcpfhirgiltynraikgnidapqvvegek
    vyvlplregnpfgdkciawpsgteitdlikddvlhwmdytvllektfikplegftsaakl
    dyekka
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >4i9qB (B:)
    mkefyltveqigdsiferyidsngrertreveykpslfahcpesqatkyfdiygkpctrk
    lfanmrdasqwikrmediglealgmddfklaylsdtynyeikydhtkirvanfdievtsp
    dgfpepsqakhpidaithydsiddrfyvfdllnspygnveewsieiaaklqeqggdevps
    eiidkiiympfdnekellmeylnfwqqktpviltgwnvesfaipyvynriknifgestak
    rlsphrktrvkvienmygsreiitlfgisvldyidlykkfsftnqpsysldyisefelnv
    gklkydgpisklresnhqryisyniiavyrvlqidakrqfinlsldmgyyakiqiqsvfs
    piktwdaiifnslkeqnkvipqgrshpvqpypgafvkepipnrykyvmsfdltslypsii
    rqvnispetiagtfkvaplhdyinavaerpsdvyscspngmmyykdrdgvvpteitkvfn
    qrkehkgymlaaqrngeiikealhnpnlsvdepldvdyrfdfsdeikekikklsakslne
    mlfraqrtevagmtaqinrkllinslagalgnvwfryydlrnataittfgqmalqwierk
    vneylnevcgtegeafvlygdtdsiyvsadkiidkvgeskfrdtnhwvdfldkfarerme
    paidrgfremceymnnkqhlmfmdreaiagpplgskgiggfwtgkkryalnvwamegtry
    aepklkimgletqksstpkavqkalkecirrmlqegeeslqeyfkefekefrqlnyisia
    svssanniakydvggfpgpkcpfhirgiltynraikgnidapqvvegekvyvlplregnp
    fgdkciawpsgteitdlikddvlhwmdytvllektfikplegftsaakldyekkaslfdm
    fdf
    

    Sequence, based on observed residues (ATOM records):
    >4i9qB (B:)
    mkefyltveqigdsiferyidsngrertreveykpslfahcpesqatkyfdiygkpctrk
    lfanmrdasqwikrmediglealgmddfklaylsdtynyeikydhtkirvanfdievtsp
    dgfpepsqakhpidaithydsiddrfyvfdllnspygnveewsieiaaklqeqggdevps
    eiidkiiympfdnekellmeylnfwqqktpviltgwnvesfaipyvynriknifgestak
    rlsphrktrvkvienmygsreiitlfgisvldyidlykkfsftnqpsysldyisefelnv
    gklkydgpisklresnhqryisyniiavyrvlqidakrqfinlsldmgyyakiqiqsvfs
    piktwdaiifnslkeqnkvipqgrshpvqpypgafvkepipnrykyvmsfdltslypsii
    rqvnispetiagtfkvaplhdyinavaerpsdvyscspngmmyykdrdgvvpteitkvfn
    qrkehkgymlaaqrngeiikealkklsakslnemlfraqrtevagmtaqinrkllinsla
    galgnvwfryydlrnataittfgqmalqwierkvneylnevcgtegeafvlygdtdsiyv
    sadkiidkvgeskfrdtnhwvdfldkfarermepaidrgfremceymnnkqhlmfmdrea
    iagpplgskgiggfwtgkkryalnvwamegtryaepklkimgletqksstpkavqkalke
    cirrmlqegeeslqeyfkefekefrqlnyisiasvssanniakydvggfpgpkcpfhirg
    iltynraikgnidapqvvegekvyvlplregnpfgdkciawpsgteitdlikddvlhwmd
    ytvllektfikplegftsaakldyekkaslfdm
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'P':
    No sequence available.

  • Chain 'T':
    No sequence available.