You accessed the SCOPe website through a deprecated URL; see Help for SCOPe 2.01 for more info on linking to SCOPe.
Showing results for SCOPe 2.06; you can access the page in SCOP 1.75 here.

PDB entry 4GP6

View 4GP6 on RCSB PDB site
Description: Polynucleotide kinase
Deposited on 2012-08-20, released 2012-11-14
The last revision was dated 2012-12-05, with a file datestamp of 2012-11-30.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.181
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Metallophosphoesterase
    Species: Clostridium thermocellum [TaxId:203119]
    Gene: Cthe_2768
    Database cross-references and differences (RAF-indexed):
    • Uniprot A3DJ38 (1-170)
      • expression tag (0)
  • Chain 'B':
    Compound: Metallophosphoesterase
    Species: Clostridium thermocellum [TaxId:203119]
    Gene: Cthe_2768
    Database cross-references and differences (RAF-indexed):
    • Uniprot A3DJ38 (1-End)
      • expression tag (0)
  • Heterogens: ADP, MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.06, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >4gp6A (A:)
    smkltipelslvvligssgsgkstfakkhfkptevissdfcrglvsddendqtvtgaafd
    vlhyivskrlqlgkltvvdatnvqesarkplieiakdyhcfpvavvfnlpekvcqernkn
    rtdrqveeyvirkhtqqlkksikglqregfryvyilnspeeveevvferqp
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >4gp6B (B:)
    smkltipelslvvligssgsgkstfakkhfkptevissdfcrglvsddendqtvtgaafd
    vlhyivskrlqlgkltvvdatnvqesarkplieiakdyhcfpvavvfnlpekvcqernkn
    rtdrqveeyvirkhtqqlkksikglqregfryvyilnspeeveevvferqp
    

    Sequence, based on observed residues (ATOM records):
    >4gp6B (B:)
    smkltipelslvvligssgsgkstfakkhfkptevissdfcrglvsddendqtvtgaafd
    vlhyivskrlqlgkltvvdatnvqesarkplieiakdyhcfpvavvfnlpekvcqernkn
    rtdrqveeyvirkhtqqlkksikglqregfryvyilnspeeveevvferq