SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.
You accessed the SCOPe website through a deprecated URL; see Help for SCOPe 2.01 for more info on linking to SCOPe.
Showing results for SCOPe 2.06; you can access the page in SCOP 1.75 here.

PDB entry 4GP6

View 4GP6 on RCSB PDB site
Description: Polynucleotide kinase
Deposited on 2012-08-20, released 2012-11-14
The last revision was dated 2012-12-05, with a file datestamp of 2012-11-30.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.181
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Metallophosphoesterase
    Species: Clostridium thermocellum [TaxId:203119]
    Gene: Cthe_2768
    Database cross-references and differences (RAF-indexed):
    • Uniprot A3DJ38 (1-170)
      • expression tag (0)
  • Chain 'B':
    Compound: Metallophosphoesterase
    Species: Clostridium thermocellum [TaxId:203119]
    Gene: Cthe_2768
    Database cross-references and differences (RAF-indexed):
    • Uniprot A3DJ38 (1-End)
      • expression tag (0)
  • Heterogens: ADP, MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.06, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >4gp6A (A:)
    smkltipelslvvligssgsgkstfakkhfkptevissdfcrglvsddendqtvtgaafd
    vlhyivskrlqlgkltvvdatnvqesarkplieiakdyhcfpvavvfnlpekvcqernkn
    rtdrqveeyvirkhtqqlkksikglqregfryvyilnspeeveevvferqp
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >4gp6B (B:)
    smkltipelslvvligssgsgkstfakkhfkptevissdfcrglvsddendqtvtgaafd
    vlhyivskrlqlgkltvvdatnvqesarkplieiakdyhcfpvavvfnlpekvcqernkn
    rtdrqveeyvirkhtqqlkksikglqregfryvyilnspeeveevvferqp
    

    Sequence, based on observed residues (ATOM records):
    >4gp6B (B:)
    smkltipelslvvligssgsgkstfakkhfkptevissdfcrglvsddendqtvtgaafd
    vlhyivskrlqlgkltvvdatnvqesarkplieiakdyhcfpvavvfnlpekvcqernkn
    rtdrqveeyvirkhtqqlkksikglqregfryvyilnspeeveevvferq