SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.
You accessed the SCOPe website through a deprecated URL; see Help for SCOPe 2.01 for more info on linking to SCOPe.
Showing results for SCOPe 2.06; you can access the page in SCOP 1.75 here.

PDB entry 4G83

View 4G83 on RCSB PDB site
Description: Crystal Structure of p73 DNA-Binding Domain Tetramer bound to a Full Response-Element
Deposited on 2012-07-20, released 2013-01-16
The last revision was dated 2013-02-20, with a file datestamp of 2013-02-15.
Experiment type: XRAY
Resolution: 4 Å
R-factor: 0.244
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tumor protein p73
    Species: Homo sapiens [TaxId:9606]
    Gene: human, P73, TP73
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15350 (12-End)
      • expression tag (10-11)
  • Chain 'B':
    Compound: Tumor protein p73
    Species: Homo sapiens [TaxId:9606]
    Gene: human, P73, TP73
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15350 (12-End)
      • expression tag (10-11)
  • Chain 'E':
    Compound: DNA
    Species: synthetic, synthetic
  • Chain 'F':
    Compound: DNA
    Species: synthetic, synthetic
  • Heterogens: ZN

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.06, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >4g83A (A:)
    mghhhhhhhhefipsntdypgphhfevtfqqsstaksatwtyspllkklycqiaktcpiq
    ikvstppppgtairampvykkaehvtdvvkrcpnhelgrdfnegqsapashlirvegnnl
    sqyvddpvtgrqsvvvpyeppqvgtefttilynfmcnsscvggmnrrpiliiitlemrdg
    qvlgrrsfegricacpgrdrkadedhyreq
    

    Sequence, based on observed residues (ATOM records):
    >4g83A (A:)
    efipsntdypgphhfevtfqqsstaksatwtyspllkklycqiaktcpiqikvstppppg
    tairampvykkaehvtdvvkrcpnhelgrdfnegqsapashlirvegnnlsqyvddpvtg
    rqsvvvpyeppqvgtefttilynfmcnsscvggmnrrpiliiitlemrdgqvlgrrsfeg
    ricacpgrdrkadedhyr
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >4g83B (B:)
    mghhhhhhhhefipsntdypgphhfevtfqqsstaksatwtyspllkklycqiaktcpiq
    ikvstppppgtairampvykkaehvtdvvkrcpnhelgrdfnegqsapashlirvegnnl
    sqyvddpvtgrqsvvvpyeppqvgtefttilynfmcnsscvggmnrrpiliiitlemrdg
    qvlgrrsfegricacpgrdrkadedhyreq
    

    Sequence, based on observed residues (ATOM records):
    >4g83B (B:)
    efipsntdypgphhfevtfqqsstaksatwtyspllkklycqiaktcpiqikvstppppg
    tairampvykkaehvtdvvkrcpnhelgrdfnegqsapashlirvegnnlsqyvddpvtg
    rqsvvvpyeppqvgtefttilynfmcnsscvggmnrrpiliiitlemrdgqvlgrrsfeg
    ricacpgrdrkadedhyr
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.