You accessed the SCOPe website through a deprecated URL; see Help for SCOPe 2.01 for more info on linking to SCOPe.
Showing results for SCOPe 2.06; you can access the page in SCOP 1.75 here.

PDB entry 4G83

View 4G83 on RCSB PDB site
Description: Crystal Structure of p73 DNA-Binding Domain Tetramer bound to a Full Response-Element
Deposited on 2012-07-20, released 2013-01-16
The last revision was dated 2013-02-20, with a file datestamp of 2013-02-15.
Experiment type: XRAY
Resolution: 4 Å
R-factor: 0.244
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tumor protein p73
    Species: Homo sapiens [TaxId:9606]
    Gene: human, P73, TP73
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15350 (12-End)
      • expression tag (10-11)
  • Chain 'B':
    Compound: Tumor protein p73
    Species: Homo sapiens [TaxId:9606]
    Gene: human, P73, TP73
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15350 (12-End)
      • expression tag (10-11)
  • Chain 'E':
    Compound: DNA
    Species: synthetic, synthetic
  • Chain 'F':
    Compound: DNA
    Species: synthetic, synthetic
  • Heterogens: ZN

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.06, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >4g83A (A:)
    mghhhhhhhhefipsntdypgphhfevtfqqsstaksatwtyspllkklycqiaktcpiq
    ikvstppppgtairampvykkaehvtdvvkrcpnhelgrdfnegqsapashlirvegnnl
    sqyvddpvtgrqsvvvpyeppqvgtefttilynfmcnsscvggmnrrpiliiitlemrdg
    qvlgrrsfegricacpgrdrkadedhyreq
    

    Sequence, based on observed residues (ATOM records):
    >4g83A (A:)
    efipsntdypgphhfevtfqqsstaksatwtyspllkklycqiaktcpiqikvstppppg
    tairampvykkaehvtdvvkrcpnhelgrdfnegqsapashlirvegnnlsqyvddpvtg
    rqsvvvpyeppqvgtefttilynfmcnsscvggmnrrpiliiitlemrdgqvlgrrsfeg
    ricacpgrdrkadedhyr
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >4g83B (B:)
    mghhhhhhhhefipsntdypgphhfevtfqqsstaksatwtyspllkklycqiaktcpiq
    ikvstppppgtairampvykkaehvtdvvkrcpnhelgrdfnegqsapashlirvegnnl
    sqyvddpvtgrqsvvvpyeppqvgtefttilynfmcnsscvggmnrrpiliiitlemrdg
    qvlgrrsfegricacpgrdrkadedhyreq
    

    Sequence, based on observed residues (ATOM records):
    >4g83B (B:)
    efipsntdypgphhfevtfqqsstaksatwtyspllkklycqiaktcpiqikvstppppg
    tairampvykkaehvtdvvkrcpnhelgrdfnegqsapashlirvegnnlsqyvddpvtg
    rqsvvvpyeppqvgtefttilynfmcnsscvggmnrrpiliiitlemrdgqvlgrrsfeg
    ricacpgrdrkadedhyr
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.