SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.
You accessed the SCOPe website through a deprecated URL; see Help for SCOPe 2.01 for more info on linking to SCOPe.
Showing results for SCOPe 2.06; you can access the page in SCOP 1.75 here.

PDB entry 4G0V

View 4G0V on RCSB PDB site
Description: Human topoisomerase iibeta in complex with DNA and mitoxantrone
Deposited on 2012-07-10, released 2013-07-17
The last revision was dated 2014-03-12, with a file datestamp of 2014-03-07.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.163
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA topoisomerase 2-beta
    Species: Homo sapiens [TaxId:9606]
    Gene: TOP2B
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: DNA topoisomerase 2-beta
    Species: Homo sapiens [TaxId:9606]
    Gene: TOP2B
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: DNA (5'-d(p*ap*gp*cp*cp*gp*ap*gp*c)-3')
  • Chain 'D':
    Compound: DNA (5'-d(p*tp*gp*cp*ap*gp*cp*tp*cp*gp*gp*cp*t)-3')
  • Chain 'E':
    Compound: DNA (5'-d(p*ap*gp*cp*cp*gp*ap*gp*c)-3')
  • Chain 'F':
    Compound: DNA (5'-d(p*tp*gp*cp*ap*gp*cp*tp*cp*gp*gp*cp*t)-3')
  • Heterogens: MIX, MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.06, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >4g0vA (A:)
    maswshpqfekgaddddkvpdptsvdsvkyskikgipklddandaggkhslectlilteg
    dsakslavsglgvigrdrygvfplrgkilnvreashkqimenaeinniikivglqykksy
    ddaeslktlrygkimimtdqdqdgshikgllinfihhnwpsllkhgfleefitpivkask
    nkqelsfysipefdewkkhienqkawkikyykglgtstakeakeyfadmerhrilfryag
    peddaaitlafskkkiddrkewltnfmedrrqrrlhglpeqflygtatkhltyndfinke
    lilfsnsdnersipslvdgfkpgqrkvlftcfkrndkrevkvaqlagsvaemsayhhgeq
    almmtivnlaqnfvgsnninllqpigqfgtrlhggkdaaspryiftmlstlarllfpavd
    dnllkflyddnqrvepewyipiipmvlingaegigtgwacklpnydareivnnvrrmldg
    ldphpmlpnyknfkgtiqelgqnqyavsgeifvvdrntveitelpvrtwtqvykeqvlep
    mlngtdktpalisdykeyhtdttvkfvvkmteeklaqaeaaglhkvfklqttltcnsmvl
    fdhmgclkkyetvqdilkeffdlrlsyyglrkewlvgmlgaestklnnqarfilekiqgk
    itienrskkdliqmlvqrgyesdpvkawkeaqekaaeedetqnqhddsssdsgtpsgpdf
    nyilnmslwsltkekveelikqrdakgrevndlkrkspsdlwkedlaafveeldkvesqe
    redgapgfssisahhhhhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >4g0vA (A:)
    kgipklddandaggkhslectliltegdsakslavsglgvigrdrygvfplrgkilnvre
    ashkqimenaeinniikivglqykksyddaeslktlrygkimimtdqdqdgshikgllin
    fihhnwpsllkhgfleefitdmerhrilfryagpeddaaitlafskkkiddrkewltnfm
    edrrqrrlhglkhltyndfinkelilfsnsdnersipslvdgfkpgqrkvlftcfkrndk
    revkvaqlagsvaemsayhhgeqalmmtivnlaqnfvgsnninllqpigqfgtrlhggkd
    aaspryiftmlstlarllfpavddnllkflyddnqrvepewyipiipmvlingaegigtg
    wacklpnydareivnnvrrmldgldphpmlpnyknfkgtiqelgqnqyavsgeifvvdrn
    tveitelpvrtwtqvykeqvlepmlngtdktpalisdykeyhtdttvkfvvkmteeklaq
    aeaaglhkvfklqttltcnsmvlfdhmgclkkyetvqdilkeffdlrlsyyglrkewlvg
    mlgaestklnnqarfilekiqgkitienrskkdliqmlvqrgyesdpvkawkeaqegpdf
    nyilnmslwsltkekveelikqrdakgrevndlkrkspsdlwkedlaafveeldkvesqe
    red
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >4g0vB (B:)
    maswshpqfekgaddddkvpdptsvdsvkyskikgipklddandaggkhslectlilteg
    dsakslavsglgvigrdrygvfplrgkilnvreashkqimenaeinniikivglqykksy
    ddaeslktlrygkimimtdqdqdgshikgllinfihhnwpsllkhgfleefitpivkask
    nkqelsfysipefdewkkhienqkawkikyykglgtstakeakeyfadmerhrilfryag
    peddaaitlafskkkiddrkewltnfmedrrqrrlhglpeqflygtatkhltyndfinke
    lilfsnsdnersipslvdgfkpgqrkvlftcfkrndkrevkvaqlagsvaemsayhhgeq
    almmtivnlaqnfvgsnninllqpigqfgtrlhggkdaaspryiftmlstlarllfpavd
    dnllkflyddnqrvepewyipiipmvlingaegigtgwacklpnydareivnnvrrmldg
    ldphpmlpnyknfkgtiqelgqnqyavsgeifvvdrntveitelpvrtwtqvykeqvlep
    mlngtdktpalisdykeyhtdttvkfvvkmteeklaqaeaaglhkvfklqttltcnsmvl
    fdhmgclkkyetvqdilkeffdlrlsyyglrkewlvgmlgaestklnnqarfilekiqgk
    itienrskkdliqmlvqrgyesdpvkawkeaqekaaeedetqnqhddsssdsgtpsgpdf
    nyilnmslwsltkekveelikqrdakgrevndlkrkspsdlwkedlaafveeldkvesqe
    redgapgfssisahhhhhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >4g0vB (B:)
    skikgipklddandaggkhslectliltegdsakslavsglgvigrdrygvfplrgkiln
    vreashkqimenaeinniikivglqykksyddaeslktlrygkimimtdqdqdgshikgl
    linfihhnwpsllkhgfleefiakeakeyfadmerhrilfryagpeddaaitlafskkki
    ddrkewltnfmedrrqrrlkhltyndfinkelilfsnsdnersipslvdgfkpgqrkvlf
    tcfkrndkrevkvaqlagsvaemsayhhgeqalmmtivnlaqnfvgsnninllqpigqfg
    trlhggkdaaspryiftmlstlarllfpavddnllkflyddnqrvepewyipiipmvlin
    gaegigtgwacklpnydareivnnvrrmldgldphpmlpnyknfkgtiqelgqnqyavsg
    eifvvdrntveitelpvrtwtqvykeqvlepmlngpalisdykeyhtdttvkfvvkmtee
    klaqaeaaglhkvfklqttltcnsmvlfdhmgclkkyetvqdilkeffdlrlsyyglrke
    wlvgmlgaestklnnqarfilekiqgkitienrskkdliqmlvqrgyesdpvkawkeaqg
    pdfnyilnmslwsltkekveelikqrdakgrevndlkrkspsdlwkedlaafveeldkve
    sqered
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.