You accessed the SCOPe website through a deprecated URL; see Help for SCOPe 2.01 for more info on linking to SCOPe.
Showing results for SCOPe 2.06; you can access the page in SCOP 1.75 here.

PDB entry 4G0V

View 4G0V on RCSB PDB site
Description: Human topoisomerase iibeta in complex with DNA and mitoxantrone
Deposited on 2012-07-10, released 2013-07-17
The last revision was dated 2014-03-12, with a file datestamp of 2014-03-07.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.163
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA topoisomerase 2-beta
    Species: Homo sapiens [TaxId:9606]
    Gene: TOP2B
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: DNA topoisomerase 2-beta
    Species: Homo sapiens [TaxId:9606]
    Gene: TOP2B
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: DNA (5'-d(p*ap*gp*cp*cp*gp*ap*gp*c)-3')
  • Chain 'D':
    Compound: DNA (5'-d(p*tp*gp*cp*ap*gp*cp*tp*cp*gp*gp*cp*t)-3')
  • Chain 'E':
    Compound: DNA (5'-d(p*ap*gp*cp*cp*gp*ap*gp*c)-3')
  • Chain 'F':
    Compound: DNA (5'-d(p*tp*gp*cp*ap*gp*cp*tp*cp*gp*gp*cp*t)-3')
  • Heterogens: MIX, MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.06, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >4g0vA (A:)
    maswshpqfekgaddddkvpdptsvdsvkyskikgipklddandaggkhslectlilteg
    dsakslavsglgvigrdrygvfplrgkilnvreashkqimenaeinniikivglqykksy
    ddaeslktlrygkimimtdqdqdgshikgllinfihhnwpsllkhgfleefitpivkask
    nkqelsfysipefdewkkhienqkawkikyykglgtstakeakeyfadmerhrilfryag
    peddaaitlafskkkiddrkewltnfmedrrqrrlhglpeqflygtatkhltyndfinke
    lilfsnsdnersipslvdgfkpgqrkvlftcfkrndkrevkvaqlagsvaemsayhhgeq
    almmtivnlaqnfvgsnninllqpigqfgtrlhggkdaaspryiftmlstlarllfpavd
    dnllkflyddnqrvepewyipiipmvlingaegigtgwacklpnydareivnnvrrmldg
    ldphpmlpnyknfkgtiqelgqnqyavsgeifvvdrntveitelpvrtwtqvykeqvlep
    mlngtdktpalisdykeyhtdttvkfvvkmteeklaqaeaaglhkvfklqttltcnsmvl
    fdhmgclkkyetvqdilkeffdlrlsyyglrkewlvgmlgaestklnnqarfilekiqgk
    itienrskkdliqmlvqrgyesdpvkawkeaqekaaeedetqnqhddsssdsgtpsgpdf
    nyilnmslwsltkekveelikqrdakgrevndlkrkspsdlwkedlaafveeldkvesqe
    redgapgfssisahhhhhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >4g0vA (A:)
    kgipklddandaggkhslectliltegdsakslavsglgvigrdrygvfplrgkilnvre
    ashkqimenaeinniikivglqykksyddaeslktlrygkimimtdqdqdgshikgllin
    fihhnwpsllkhgfleefitdmerhrilfryagpeddaaitlafskkkiddrkewltnfm
    edrrqrrlhglkhltyndfinkelilfsnsdnersipslvdgfkpgqrkvlftcfkrndk
    revkvaqlagsvaemsayhhgeqalmmtivnlaqnfvgsnninllqpigqfgtrlhggkd
    aaspryiftmlstlarllfpavddnllkflyddnqrvepewyipiipmvlingaegigtg
    wacklpnydareivnnvrrmldgldphpmlpnyknfkgtiqelgqnqyavsgeifvvdrn
    tveitelpvrtwtqvykeqvlepmlngtdktpalisdykeyhtdttvkfvvkmteeklaq
    aeaaglhkvfklqttltcnsmvlfdhmgclkkyetvqdilkeffdlrlsyyglrkewlvg
    mlgaestklnnqarfilekiqgkitienrskkdliqmlvqrgyesdpvkawkeaqegpdf
    nyilnmslwsltkekveelikqrdakgrevndlkrkspsdlwkedlaafveeldkvesqe
    red
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >4g0vB (B:)
    maswshpqfekgaddddkvpdptsvdsvkyskikgipklddandaggkhslectlilteg
    dsakslavsglgvigrdrygvfplrgkilnvreashkqimenaeinniikivglqykksy
    ddaeslktlrygkimimtdqdqdgshikgllinfihhnwpsllkhgfleefitpivkask
    nkqelsfysipefdewkkhienqkawkikyykglgtstakeakeyfadmerhrilfryag
    peddaaitlafskkkiddrkewltnfmedrrqrrlhglpeqflygtatkhltyndfinke
    lilfsnsdnersipslvdgfkpgqrkvlftcfkrndkrevkvaqlagsvaemsayhhgeq
    almmtivnlaqnfvgsnninllqpigqfgtrlhggkdaaspryiftmlstlarllfpavd
    dnllkflyddnqrvepewyipiipmvlingaegigtgwacklpnydareivnnvrrmldg
    ldphpmlpnyknfkgtiqelgqnqyavsgeifvvdrntveitelpvrtwtqvykeqvlep
    mlngtdktpalisdykeyhtdttvkfvvkmteeklaqaeaaglhkvfklqttltcnsmvl
    fdhmgclkkyetvqdilkeffdlrlsyyglrkewlvgmlgaestklnnqarfilekiqgk
    itienrskkdliqmlvqrgyesdpvkawkeaqekaaeedetqnqhddsssdsgtpsgpdf
    nyilnmslwsltkekveelikqrdakgrevndlkrkspsdlwkedlaafveeldkvesqe
    redgapgfssisahhhhhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >4g0vB (B:)
    skikgipklddandaggkhslectliltegdsakslavsglgvigrdrygvfplrgkiln
    vreashkqimenaeinniikivglqykksyddaeslktlrygkimimtdqdqdgshikgl
    linfihhnwpsllkhgfleefiakeakeyfadmerhrilfryagpeddaaitlafskkki
    ddrkewltnfmedrrqrrlkhltyndfinkelilfsnsdnersipslvdgfkpgqrkvlf
    tcfkrndkrevkvaqlagsvaemsayhhgeqalmmtivnlaqnfvgsnninllqpigqfg
    trlhggkdaaspryiftmlstlarllfpavddnllkflyddnqrvepewyipiipmvlin
    gaegigtgwacklpnydareivnnvrrmldgldphpmlpnyknfkgtiqelgqnqyavsg
    eifvvdrntveitelpvrtwtqvykeqvlepmlngpalisdykeyhtdttvkfvvkmtee
    klaqaeaaglhkvfklqttltcnsmvlfdhmgclkkyetvqdilkeffdlrlsyyglrke
    wlvgmlgaestklnnqarfilekiqgkitienrskkdliqmlvqrgyesdpvkawkeaqg
    pdfnyilnmslwsltkekveelikqrdakgrevndlkrkspsdlwkedlaafveeldkve
    sqered
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.