You accessed the SCOPe website through a deprecated URL; see Help for SCOPe 2.01 for more info on linking to SCOPe.
Showing results for SCOPe 2.06; you can access the page in SCOP 1.75 here.

PDB entry 4FBU

View 4FBU on RCSB PDB site
Description: Dpo4 polymerase pre-insertion binary complex with the N-(deoxyguanosin-8-yl)-1-aminopyrene lesion
Deposited on 2012-05-23, released 2013-06-12
The last revision was dated 2013-11-13, with a file datestamp of 2013-11-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.22
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase IV
    Species: Sulfolobus solfataricus [TaxId:273057]
    Gene: DBH, DPO4, SSO2448
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: DNA polymerase IV
    Species: Sulfolobus solfataricus [TaxId:273057]
    Gene: DBH, DPO4, SSO2448
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: DNA Template
    Species: synthetic, synthetic
  • Chain 'D':
    Compound: DNA Primer
    Species: synthetic, synthetic
  • Chain 'P':
    Compound: DNA Primer
    Species: synthetic, synthetic
  • Chain 'T':
    Compound: DNA Template
    Species: synthetic, synthetic
  • Heterogens: CA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.06, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >4fbuA (A:)
    mivlfvdfdyfyaqveevlnpslkgkpvvvcvfsgrfedsgavatanyearkfgvkagip
    iveakkilpnavylpmrkevyqqvssrimnllreysekieiasideayldisdkvrdyre
    aynlgleiknkilekekitvtvgisknkvfakiaadmakpngikviddeevkrlireldi
    advpgignitaeklkklginklvdtlsiefdklkgmigeakakylislardeynepirtr
    vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr
    tfphgisketaysesvkllqkileederkirrigvrfskfi
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >4fbuB (B:)
    mivlfvdfdyfyaqveevlnpslkgkpvvvcvfsgrfedsgavatanyearkfgvkagip
    iveakkilpnavylpmrkevyqqvssrimnllreysekieiasideayldisdkvrdyre
    aynlgleiknkilekekitvtvgisknkvfakiaadmakpngikviddeevkrlireldi
    advpgignitaeklkklginklvdtlsiefdklkgmigeakakylislardeynepirtr
    vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr
    tfphgisketaysesvkllqkileederkirrigvrfskfi
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'P':
    No sequence available.

  • Chain 'T':
    No sequence available.