You accessed the SCOPe website through a deprecated URL; see Help for SCOPe 2.01 for more info on linking to SCOPe.
Showing results for SCOPe 2.06; you can access the page in SCOP 1.75 here.

PDB entry 4CEJ

View 4CEJ on RCSB PDB site
Description: Crystal structure of ADPNP-bound AddAB bound to Chi
Deposited on 2013-11-11, released 2014-03-12
The last revision was dated 2014-04-23, with a file datestamp of 2014-04-18.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.2048
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent helicase/nuclease subunit A
    Species: BACILLUS SUBTILIS SUBSP. SUBTILIS STR. 168 [TaxId:224308]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23478 (Start-1231)
      • variant (779)
      • engineered mutation (1171)
  • Chain 'B':
    Compound: ATP-dependent helicase/deoxyribonuclease subunit B
    Species: BACILLUS SUBTILIS SUBSP. SUBTILIS STR. 168 [TaxId:224308]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23477
      • variant (842-843)
      • engineered mutation (960)
  • Chain 'X':
    Compound: DNA
    Species: synthetic construct, synthetic [TaxId:32630]
  • Heterogens: ANP, MG, SF4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.06, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >4cejA (A:)
    mnipkpadstwtddqwnaivstgqdilvaaaagsgktavlvermirkitaeenpidvdrl
    lvvtftnasaaemkhriaealekelvqrpgslhirrqlsllnrasistlhsfclqvlkky
    yylidldpgfriadqtegeligdevldelfedeyakgekaffelvdryttdrhdldlqfl
    vkqvyeysrshpnpeawlesfvhlydvseksaieelpfyqyvkediamvlngakekllra
    leltkapggpapradnflddlaqideliqhqddfselykrvpavsfkrakavkgdefdpa
    lldeatdlrngakklleklktdyftrspeqhlkslaemkpvietlvqlvisygkrfeaak
    qeksiidfsdlehyclailtaendkgerepseaarfyqeqfhevlvdeyqdtnlvqesil
    qlvtsgpeetgnlfmvgdvkqsiyrfrlaepllflskykrftesgegtgrkidlnknfrs
    radildstnflfkqlmggkigevdydeqaelklgaaypdndetetelllidnaedtdase
    eaeeletvqfeakaiakeirklisspfkvydgkkkthrniqyrdivillrsmpwapqime
    elraqgipvyanltsgyfeavevavalsvlkvidnpyqdiplasvlrspivgadenelsl
    irlenkkapyyeamkdylaagdrsdelyqklntfyghlqkwrafsknhsvseliwevyrd
    tkymdyvggmpggkqrqanlrvlydrarqyestafrglfrflrfiermqergddlgtarg
    lseqedvvrlmtihsskglefpvvfvaglgrnfnmmdlnksylldkelgfgtkyihpqlr
    isyptlpliamkkkmrrellseelrvlyvaltrakeklfligsckdhqkqlakwqasasq
    tdwllpefdryqartyldfigpalarhrdlgdlagvpahadisghparfavqmihsydll
    dddleermeekserleairrgepvpgsfafdekareqlswtyphqevtqirtkqsvseik
    rkreyedeysgrapvkpadgsilyrrpafmmkkgltaaekgtamhtvmqhiplshvpsie
    eaeqtvhrlyekellteeqkdaidieeivqffhteiggqligakwkdreipfslalpake
    iypdaheadepllvqgiidclyetedglyllayksdriegkfqhgfegaapilkkryetq
    iqlytkaveqiaktkvkgcalyffdgghiltl
    

    Sequence, based on observed residues (ATOM records):
    >4cejA (A:)
    twtddqwnaivstgqdilvaaaagsgktavlvermirkitaeenpidvdrllvvtftnas
    aaemkhriaealekelvqrpgslhirrqlsllnrasistlhsfclqvlkkyyylidldpg
    friadqtegeligdevldelfedeyakgekaffelvdryttdrhdldlqflvkqvyeysr
    shpnpeawlesfvhlydvseksaieelpfyqyvkediamvlngakekllraleltkapgg
    papradnflddlaqideliqhqddfselykrvpavsfkrakavkgdefdpalldeatdlr
    ngakklleklktdyftrspeqhlkslaemkpvietlvqlvisygkrfeaakqeksiidfs
    dlehyclailtaendkgerepseaarfyqeqfhevlvdeyqdtnlvqesilqlvtsgpee
    tgnlfmvgdvkqsiyrfrlaepllflskykrftesgegtgrkidlnknfrsradildstn
    flfkqlmggkigevdydeqaelklgaaypdndetetelllideletvqfeakaiakeirk
    lisspfkvydgkkkthrniqyrdivillrsmpwapqimeelraqgipvyanltsgyfeav
    evavalsvlkvidnpyqdiplasvlrspivgadenelslirlenkkapyyeamkdylaag
    drsdelyqklntfyghlqkwrafsknhsvseliwevyrdtkymdyvggmpggkqrqanlr
    vlydrarqyestafrglfrflrfiermqergddlgtarglseqedvvrlmtihsskglef
    pvvfvaglgrnfnmmdlnksylldkelgfgtkyihpqlrisyptlpliamkkkmrrells
    eelrvlyvaltrakeklfligsckdhqkqlakwqasasqtdwllpefdryqartyldfig
    palarhrdlhadisghparfavqmihsydlldermeekserleairrgepvpgsfafdek
    areqlswtyphqevtqirtkqsvseikryrrpafmmkkgltaaekgtamhtvmqhiplsh
    vpsieeaeqtvhrlyekellteeqkdaidieeivqffhteiggqligakwkdreipfsla
    lpakeiypdaheadepllvqgiidclyetedglyllayksdriegkfqhgfegaapilkk
    ryetqiqlytkaveqiaktkvkgcalyffdgghiltl
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >4cejB (B:)
    mgaeflvgrsgsgktkliinsiqdelrrapfgkpiiflvpdqmtflmeyelaktpdmggm
    iraqvfsfsrlawrvlqhtggmsrpfltstgvqmllrklieehkqefkvyqkasdksgft
    aqvermltefkryclepedirrmaesgtaseyrgervlseklhdlsilyqqmeksladqy
    lhsedyltllaehiplaedikgahiyvdgfyqftpqefrvleqlmvhaehitfsltadkp
    syerephelelfrmtgktyyrlhqkakelnlditykelsgterhtktpelahleaqyear
    paipyaekqealtvmqaanrraelegiareihalvrekgyrykdvailarqpedykdmvk
    evfadyeipyfidgkasmlnhpliefirssldvlkgnwryeavfrcvktellfplnepka
    kvreqvdqlenyciaygikgdrwtkgdrfqyrrfvsldddfaqtdqeiemenmlndtrdw
    ivpplfqlqkrmkkaktvqekaealyryleetdvplkldqerqraeddgriieaqqhqqa
    wdaviqlleefvemmgddeisldlfqqmieagaesltfslippaldqvfvgnmdlsrmyg
    tsctfvlgandgvlparpdengvlsdddrewlktigvelssggrerlldehfliymafss
    psdrlyvsypiadaegktllpsmivkrleelfphhkerlltnepeqvsdeeqlmyvvnks
    vaqsftasqlrlwtreydisdvwwstynvlmseqdrlqskklfsslffrnevkqlersvs
    rqlygeriqgsvsrmetfnacpfshfashglhlkerqffkleapdigqlfhsslklisdr
    lrdekldwrdltkeqcelfsydaverlapklqkeillssnrhyyvkeklqkivtrvsgil
    sehakasgfvpiglelgfggkgplppltfqlkngctmelvgridrvdkaesskglllriv
    aykssdkgldlaevyyglalqmltyldlsithsadwlgmratpagvlyfhihdpmiqsnl
    plgldeieqeifkkfkmkglllgdqevvrlmdttlqegrsniinaglkkdgslrsdsaav
    gekefdlltkhvrrtfqeageqitdgrvsiepykmknktpctycafksvcqfdesleene
    yrplkaekdktilewikkeadgnehs
    

    Sequence, based on observed residues (ATOM records):
    >4cejB (B:)
    gaeflvgrsgsgktkliinsiqdelrrapfgkpiiflvpdqmtflmeyelaktpdmggmi
    raqvfsfsrlawrvlqhtggmsrpfltstgvqmllrklieehkqefkvyqkasdksgfta
    qvermltefkryclepedirrmaesgtayrgervlseklhdlsilyqqmeksladqylhs
    edyltllaehiplaedikgahiyvdgfyqftpqefrvleqlmvhaehitfsltadkpsye
    rephelelfrmtgktyyrlhqkakelnlditykelsgterhtktpelahleaqyearpai
    pyaekqealtvmqaanrraelegiareihalvrekgyrykdvailarqpedykdmvkevf
    adyeipyfidgkasmlnhpliefirssldvlkgnwryeavfrcvktellfplnepkakvr
    eqvdqlenyciaygikgdrwtkgdrfqyrrfvsldddfaqtdqeiemenmlndtrdwivp
    plfqlqkrmkkaktvqekaealyryleetdvplkldqerqraeddgriieaqqhqqawda
    viqlleefvemmgddeisldlfqqmieagaesltfslippaldqvfvgnmdlsrmygtsc
    tfvlgandgvlparpdengvlsdddrewlktigvelssggrerlldehfliymafsspsd
    rlyvsypiadaegktllpsmivkrleelfphhkerlltnepeqvsdeeqlmyvvnksvaq
    sftasqlrlwtreydisdvwwstynvlmseqdrlqskklfsslffrnevkqlersvsrql
    ygeriqgsvsrmetfnacpfshfashglhlkerqffkleapdigqlfhsslklisdrlrd
    ekldwrdltkeqcelfsydaverlapklqkeillssnrhyyvkeklqkivtrvsgilseh
    akasgfvpiglelgfggkgplppltfqlkngctmelvgridrvdkaesskglllrivayk
    ssdkgldlaevyyglalqmltyldlsithsadwlgmratpagvlyfhihdpmiqsnlplg
    ldeieqeifkkfkmkglllgdqevvrlmdttlqegrsniinaglkkdgslrsdsaavgek
    efdlltkhvrrtfqeageqitdgrvsiepykmknktpctycafksvcqfdesleeneyrp
    lkaekdktilewikke
    

  • Chain 'X':
    No sequence available.