SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.
You accessed the SCOPe website through a deprecated URL; see Help for SCOPe 2.01 for more info on linking to SCOPe.
Showing results for SCOPe 2.06; you can access the page in SCOP 1.75 here.

PDB entry 4CEJ

View 4CEJ on RCSB PDB site
Description: Crystal structure of ADPNP-bound AddAB bound to Chi
Deposited on 2013-11-11, released 2014-03-12
The last revision was dated 2014-04-23, with a file datestamp of 2014-04-18.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.2048
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent helicase/nuclease subunit A
    Species: BACILLUS SUBTILIS SUBSP. SUBTILIS STR. 168 [TaxId:224308]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23478 (Start-1231)
      • variant (779)
      • engineered mutation (1171)
  • Chain 'B':
    Compound: ATP-dependent helicase/deoxyribonuclease subunit B
    Species: BACILLUS SUBTILIS SUBSP. SUBTILIS STR. 168 [TaxId:224308]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23477
      • variant (842-843)
      • engineered mutation (960)
  • Chain 'X':
    Compound: DNA
    Species: synthetic construct, synthetic [TaxId:32630]
  • Heterogens: ANP, MG, SF4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.06, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >4cejA (A:)
    mnipkpadstwtddqwnaivstgqdilvaaaagsgktavlvermirkitaeenpidvdrl
    lvvtftnasaaemkhriaealekelvqrpgslhirrqlsllnrasistlhsfclqvlkky
    yylidldpgfriadqtegeligdevldelfedeyakgekaffelvdryttdrhdldlqfl
    vkqvyeysrshpnpeawlesfvhlydvseksaieelpfyqyvkediamvlngakekllra
    leltkapggpapradnflddlaqideliqhqddfselykrvpavsfkrakavkgdefdpa
    lldeatdlrngakklleklktdyftrspeqhlkslaemkpvietlvqlvisygkrfeaak
    qeksiidfsdlehyclailtaendkgerepseaarfyqeqfhevlvdeyqdtnlvqesil
    qlvtsgpeetgnlfmvgdvkqsiyrfrlaepllflskykrftesgegtgrkidlnknfrs
    radildstnflfkqlmggkigevdydeqaelklgaaypdndetetelllidnaedtdase
    eaeeletvqfeakaiakeirklisspfkvydgkkkthrniqyrdivillrsmpwapqime
    elraqgipvyanltsgyfeavevavalsvlkvidnpyqdiplasvlrspivgadenelsl
    irlenkkapyyeamkdylaagdrsdelyqklntfyghlqkwrafsknhsvseliwevyrd
    tkymdyvggmpggkqrqanlrvlydrarqyestafrglfrflrfiermqergddlgtarg
    lseqedvvrlmtihsskglefpvvfvaglgrnfnmmdlnksylldkelgfgtkyihpqlr
    isyptlpliamkkkmrrellseelrvlyvaltrakeklfligsckdhqkqlakwqasasq
    tdwllpefdryqartyldfigpalarhrdlgdlagvpahadisghparfavqmihsydll
    dddleermeekserleairrgepvpgsfafdekareqlswtyphqevtqirtkqsvseik
    rkreyedeysgrapvkpadgsilyrrpafmmkkgltaaekgtamhtvmqhiplshvpsie
    eaeqtvhrlyekellteeqkdaidieeivqffhteiggqligakwkdreipfslalpake
    iypdaheadepllvqgiidclyetedglyllayksdriegkfqhgfegaapilkkryetq
    iqlytkaveqiaktkvkgcalyffdgghiltl
    

    Sequence, based on observed residues (ATOM records):
    >4cejA (A:)
    twtddqwnaivstgqdilvaaaagsgktavlvermirkitaeenpidvdrllvvtftnas
    aaemkhriaealekelvqrpgslhirrqlsllnrasistlhsfclqvlkkyyylidldpg
    friadqtegeligdevldelfedeyakgekaffelvdryttdrhdldlqflvkqvyeysr
    shpnpeawlesfvhlydvseksaieelpfyqyvkediamvlngakekllraleltkapgg
    papradnflddlaqideliqhqddfselykrvpavsfkrakavkgdefdpalldeatdlr
    ngakklleklktdyftrspeqhlkslaemkpvietlvqlvisygkrfeaakqeksiidfs
    dlehyclailtaendkgerepseaarfyqeqfhevlvdeyqdtnlvqesilqlvtsgpee
    tgnlfmvgdvkqsiyrfrlaepllflskykrftesgegtgrkidlnknfrsradildstn
    flfkqlmggkigevdydeqaelklgaaypdndetetelllideletvqfeakaiakeirk
    lisspfkvydgkkkthrniqyrdivillrsmpwapqimeelraqgipvyanltsgyfeav
    evavalsvlkvidnpyqdiplasvlrspivgadenelslirlenkkapyyeamkdylaag
    drsdelyqklntfyghlqkwrafsknhsvseliwevyrdtkymdyvggmpggkqrqanlr
    vlydrarqyestafrglfrflrfiermqergddlgtarglseqedvvrlmtihsskglef
    pvvfvaglgrnfnmmdlnksylldkelgfgtkyihpqlrisyptlpliamkkkmrrells
    eelrvlyvaltrakeklfligsckdhqkqlakwqasasqtdwllpefdryqartyldfig
    palarhrdlhadisghparfavqmihsydlldermeekserleairrgepvpgsfafdek
    areqlswtyphqevtqirtkqsvseikryrrpafmmkkgltaaekgtamhtvmqhiplsh
    vpsieeaeqtvhrlyekellteeqkdaidieeivqffhteiggqligakwkdreipfsla
    lpakeiypdaheadepllvqgiidclyetedglyllayksdriegkfqhgfegaapilkk
    ryetqiqlytkaveqiaktkvkgcalyffdgghiltl
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >4cejB (B:)
    mgaeflvgrsgsgktkliinsiqdelrrapfgkpiiflvpdqmtflmeyelaktpdmggm
    iraqvfsfsrlawrvlqhtggmsrpfltstgvqmllrklieehkqefkvyqkasdksgft
    aqvermltefkryclepedirrmaesgtaseyrgervlseklhdlsilyqqmeksladqy
    lhsedyltllaehiplaedikgahiyvdgfyqftpqefrvleqlmvhaehitfsltadkp
    syerephelelfrmtgktyyrlhqkakelnlditykelsgterhtktpelahleaqyear
    paipyaekqealtvmqaanrraelegiareihalvrekgyrykdvailarqpedykdmvk
    evfadyeipyfidgkasmlnhpliefirssldvlkgnwryeavfrcvktellfplnepka
    kvreqvdqlenyciaygikgdrwtkgdrfqyrrfvsldddfaqtdqeiemenmlndtrdw
    ivpplfqlqkrmkkaktvqekaealyryleetdvplkldqerqraeddgriieaqqhqqa
    wdaviqlleefvemmgddeisldlfqqmieagaesltfslippaldqvfvgnmdlsrmyg
    tsctfvlgandgvlparpdengvlsdddrewlktigvelssggrerlldehfliymafss
    psdrlyvsypiadaegktllpsmivkrleelfphhkerlltnepeqvsdeeqlmyvvnks
    vaqsftasqlrlwtreydisdvwwstynvlmseqdrlqskklfsslffrnevkqlersvs
    rqlygeriqgsvsrmetfnacpfshfashglhlkerqffkleapdigqlfhsslklisdr
    lrdekldwrdltkeqcelfsydaverlapklqkeillssnrhyyvkeklqkivtrvsgil
    sehakasgfvpiglelgfggkgplppltfqlkngctmelvgridrvdkaesskglllriv
    aykssdkgldlaevyyglalqmltyldlsithsadwlgmratpagvlyfhihdpmiqsnl
    plgldeieqeifkkfkmkglllgdqevvrlmdttlqegrsniinaglkkdgslrsdsaav
    gekefdlltkhvrrtfqeageqitdgrvsiepykmknktpctycafksvcqfdesleene
    yrplkaekdktilewikkeadgnehs
    

    Sequence, based on observed residues (ATOM records):
    >4cejB (B:)
    gaeflvgrsgsgktkliinsiqdelrrapfgkpiiflvpdqmtflmeyelaktpdmggmi
    raqvfsfsrlawrvlqhtggmsrpfltstgvqmllrklieehkqefkvyqkasdksgfta
    qvermltefkryclepedirrmaesgtayrgervlseklhdlsilyqqmeksladqylhs
    edyltllaehiplaedikgahiyvdgfyqftpqefrvleqlmvhaehitfsltadkpsye
    rephelelfrmtgktyyrlhqkakelnlditykelsgterhtktpelahleaqyearpai
    pyaekqealtvmqaanrraelegiareihalvrekgyrykdvailarqpedykdmvkevf
    adyeipyfidgkasmlnhpliefirssldvlkgnwryeavfrcvktellfplnepkakvr
    eqvdqlenyciaygikgdrwtkgdrfqyrrfvsldddfaqtdqeiemenmlndtrdwivp
    plfqlqkrmkkaktvqekaealyryleetdvplkldqerqraeddgriieaqqhqqawda
    viqlleefvemmgddeisldlfqqmieagaesltfslippaldqvfvgnmdlsrmygtsc
    tfvlgandgvlparpdengvlsdddrewlktigvelssggrerlldehfliymafsspsd
    rlyvsypiadaegktllpsmivkrleelfphhkerlltnepeqvsdeeqlmyvvnksvaq
    sftasqlrlwtreydisdvwwstynvlmseqdrlqskklfsslffrnevkqlersvsrql
    ygeriqgsvsrmetfnacpfshfashglhlkerqffkleapdigqlfhsslklisdrlrd
    ekldwrdltkeqcelfsydaverlapklqkeillssnrhyyvkeklqkivtrvsgilseh
    akasgfvpiglelgfggkgplppltfqlkngctmelvgridrvdkaesskglllrivayk
    ssdkgldlaevyyglalqmltyldlsithsadwlgmratpagvlyfhihdpmiqsnlplg
    ldeieqeifkkfkmkglllgdqevvrlmdttlqegrsniinaglkkdgslrsdsaavgek
    efdlltkhvrrtfqeageqitdgrvsiepykmknktpctycafksvcqfdesleeneyrp
    lkaekdktilewikke
    

  • Chain 'X':
    No sequence available.