PDB entry 451c

View 451c on RCSB PDB site
Description: structure of cytochrome c551 from p. aeruginosa refined at 1.6 angstroms resolution and comparison of the two redox forms
Class: electron transport
Keywords: electron transport
Deposited on 1981-07-20, released 1981-10-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.187
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c551
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d451ca_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >451cA (A:)
    edpevlfknkgcvachaidtkmvgpaykdvaakfagqagaeaelaqrikngsqgvwgpip
    mppnavsddeaqtlakwvlsqk