PDB entry 451c

View 451c on RCSB PDB site
Description: structure of cytochrome c551 from p. aeruginosa refined at 1.6 angstroms resolution and comparison of the two redox forms
Deposited on 1981-07-20, released 1981-10-02
The last revision prior to the SCOP 1.55 freeze date was dated 1983-09-30, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.6 Å
R-factor: 0.187
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d451c__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >451c_ (-)
    edpevlfknkgcvachaidtkmvgpaykdvaakfagqagaeaelaqrikngsqgvwgpip
    mppnavsddeaqtlakwvlsqk