PDB entry 43ca

View 43ca on RCSB PDB site
Description:
Deposited on 1999-03-10, released 1999-08-18
The last revision prior to the SCOP 1.55 freeze date was dated 1999-08-18, with a file datestamp of 1999-08-17.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.206
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d43caa_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d43cab_
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d43cac_
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d43cad_
  • Chain 'E':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d43cae_
  • Chain 'F':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d43caf_
  • Chain 'G':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d43cag_
  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d43cah_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >43caA (A:)
    dvvmtqtpsslamsvgqkvtmsckssqsllnisnqknylawyqqkpgqspkllvyfastr
    esgvpdrfigsgsgtdftltissvqaedqadyfcqqhyraprtfgggtkleik
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >43caB (B:)
    qvqlvesgpglvapsqslsitctvsgislsrynvhwvrqspgkglewlgmiwgggsieyn
    palksrlsiskdnsksqiflkmnslqtddsamyycvsygyggdrfsywgqgtlvtvs
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >43caC (C:)
    dvvmtqtpsslamsvgqkvtmsckssqsllnisnqknylawyqqkpgqspkllvyfastr
    esgvpdrfigsgsgtdftltissvqaedqadyfcqqhyraprtfgggtkleik
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >43caD (D:)
    qvqlvesgpglvapsqslsitctvsgislsrynvhwvrqspgkglewlgmiwgggsieyn
    palksrlsiskdnsksqiflkmnslqtddsamyycvsygyggdrfsywgqgtlvtvs
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >43caE (E:)
    dvvmtqtpsslamsvgqkvtmsckssqsllnisnqknylawyqqkpgqspkllvyfastr
    esgvpdrfigsgsgtdftltissvqaedqadyfcqqhyraprtfgggtkleik
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >43caF (F:)
    qvqlvesgpglvapsqslsitctvsgislsrynvhwvrqspgkglewlgmiwgggsieyn
    palksrlsiskdnsksqiflkmnslqtddsamyycvsygyggdrfsywgqgtlvtvs
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >43caG (G:)
    dvvmtqtpsslamsvgqkvtmsckssqsllnisnqknylawyqqkpgqspkllvyfastr
    esgvpdrfigsgsgtdftltissvqaedqadyfcqqhyraprtfgggtkleik
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >43caH (H:)
    qvqlvesgpglvapsqslsitctvsgislsrynvhwvrqspgkglewlgmiwgggsieyn
    palksrlsiskdnsksqiflkmnslqtddsamyycvsygyggdrfsywgqgtlvtvs