PDB entry 43c9

View 43c9 on RCSB PDB site
Description: crystallographic structure of the esterolytic and amidolytic 43c9 antibody
Class: immunoglobulin
Keywords: immunoglobulin
Deposited on 1999-03-10, released 1999-08-18
The last revision prior to the SCOP 1.73 freeze date was dated 2002-07-24, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.21
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (immunoglobulin (light chain))
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d43c9a_
  • Chain 'B':
    Compound: protein (immunoglobulin (heavy chain))
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d43c9b_
  • Chain 'C':
    Compound: protein (immunoglobulin (light chain))
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d43c9c_
  • Chain 'D':
    Compound: protein (immunoglobulin (heavy chain))
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d43c9d_
  • Chain 'E':
    Compound: protein (immunoglobulin (light chain))
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d43c9e_
  • Chain 'F':
    Compound: protein (immunoglobulin (heavy chain))
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d43c9f_
  • Chain 'G':
    Compound: protein (immunoglobulin (light chain))
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d43c9g_
  • Chain 'H':
    Compound: protein (immunoglobulin (heavy chain))
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d43c9h_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >43c9A (A:)
    dvvmtqtpsslamsvgqkvtmsckssqsllnisnqknylawyqqkpgqspkllvyfastr
    esgvpdrfigsgsgtdftltissvqaedqadyfcqqhyraprtfgggtkleik
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >43c9B (B:)
    gqvqlvesgpglvapsqslsitctvsgislsrynvhwvrqspgkglewlgmiwgggsiey
    npalksrlsiskdnsksqiflkmnslqtddsamyycvsygyggdrfsywgqgtlvtvs
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >43c9C (C:)
    dvvmtqtpsslamsvgqkvtmsckssqsllnisnqknylawyqqkpgqspkllvyfastr
    esgvpdrfigsgsgtdftltissvqaedqadyfcqqhyraprtfgggtkleik
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >43c9D (D:)
    gqvqlvesgpglvapsqslsitctvsgislsrynvhwvrqspgkglewlgmiwgggsiey
    npalksrlsiskdnsksqiflkmnslqtddsamyycvsygyggdrfsywgqgtlvtvs
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >43c9E (E:)
    dvvmtqtpsslamsvgqkvtmsckssqsllnisnqknylawyqqkpgqspkllvyfastr
    esgvpdrfigsgsgtdftltissvqaedqadyfcqqhyraprtfgggtkleik
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >43c9F (F:)
    gqvqlvesgpglvapsqslsitctvsgislsrynvhwvrqspgkglewlgmiwgggsiey
    npalksrlsiskdnsksqiflkmnslqtddsamyycvsygyggdrfsywgqgtlvtvs
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >43c9G (G:)
    dvvmtqtpsslamsvgqkvtmsckssqsllnisnqknylawyqqkpgqspkllvyfastr
    esgvpdrfigsgsgtdftltissvqaedqadyfcqqhyraprtfgggtkleik
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >43c9H (H:)
    gqvqlvesgpglvapsqslsitctvsgislsrynvhwvrqspgkglewlgmiwgggsiey
    npalksrlsiskdnsksqiflkmnslqtddsamyycvsygyggdrfsywgqgtlvtvs