PDB entry 3zzy

View 3zzy on RCSB PDB site
Description: Crystal structure of a Raver1 PRI3 peptide in complex with polypyrimidine tract binding protein RRM2
Class: protein binding
Keywords: protein binding, peptide binding, RNA recognition motif
Deposited on 2011-09-06, released 2011-12-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-12-28, with a file datestamp of 2011-12-23.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.224
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polypyrimidine tract-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3zzya_
  • Chain 'B':
    Compound: Polypyrimidine tract-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3zzyb_
  • Chain 'C':
    Compound: Ribonucleoprotein PTB-binding 1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9CW46
      • engineered mutation (11)
  • Chain 'D':
    Compound: Ribonucleoprotein PTB-binding 1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9CW46
      • engineered mutation (11)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3zzyA (A:)
    svqsgnlalaasaaavdagmamagqspvlriivenlfypvtldvlhqifskfgtvlkiit
    ftknnqfqallqyadpvsaqhaklsldgqniynacctlridfskltslnvkynndksrdy
    trpdlpsgds
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zzyA (A:)
    qspvlriivenlfypvtldvlhqifskfgtvlkiitftknnqfqallqyadpvsaqhakl
    sldgqniynacctlridfskltslnvkynndksrdytrpdlpsgds
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3zzyB (B:)
    svqsgnlalaasaaavdagmamagqspvlriivenlfypvtldvlhqifskfgtvlkiit
    ftknnqfqallqyadpvsaqhaklsldgqniynacctlridfskltslnvkynndksrdy
    trpdlpsgds
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zzyB (B:)
    qspvlriivenlfypvtldvlhqifskfgtvlkiitftknnqfqallqyadpvsaqhakl
    sldgqniynacctlridfskltslnvkynndksrdytrpdlpsg
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.