PDB entry 3zzx

View 3zzx on RCSB PDB site
Description: Crystallographic structure of thioredoxin from Litopenaeus vannamei
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2011-09-05, released 2012-09-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-05, with a file datestamp of 2013-05-31.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: 0.1847
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioredoxin
    Species: LITOPENAEUS VANNAMEI [TaxId:6689]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B1PWB9 (0-104)
      • conflict (10)
    Domains in SCOPe 2.07: d3zzxa_
  • Chain 'B':
    Compound: thioredoxin
    Species: LITOPENAEUS VANNAMEI [TaxId:6689]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B1PWB9 (0-104)
      • conflict (10)
    Domains in SCOPe 2.07: d3zzxb_
  • Heterogens: DTU, ACT, GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3zzxA (A:)
    mvyqvkdqedftkqlneagnklvvidfyatwcgpckmiapkleelsqsmsdvvflkvdvd
    ecediaqdnqiacmptflfmkngqkldslsganydkllelveknk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3zzxB (B:)
    mvyqvkdqedftkqlneagnklvvidfyatwcgpckmiapkleelsqsmsdvvflkvdvd
    ecediaqdnqiacmptflfmkngqkldslsganydkllelveknk