PDB entry 3zzl
View 3zzl on RCSB PDB site
Description: bacillus halodurans trp RNA-binding attenuation protein (trap): a 12-subunit assembly
Class: transcription
Keywords: transcription, transcription regulation, protein engineering
Deposited on
2011-09-01, released
2011-10-12
The last revision prior to the SCOPe 2.08 freeze date was dated
2011-10-26, with a file datestamp of
2011-10-21.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: 0.18051
AEROSPACI score: 0.57
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: transcription attenuation protein mtrb
Species: Bacillus halodurans [TaxId:86665]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3zzla_ - Chain 'B':
Compound: transcription attenuation protein mtrb
Species: Bacillus halodurans [TaxId:86665]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3zzlb_ - Chain 'C':
Compound: transcription attenuation protein mtrb
Species: Bacillus halodurans [TaxId:86665]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3zzlc_ - Heterogens: TRP, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3zzlA (A:)
snffvikakengvnvfgmtrgtdtrfhhsekldkgevmiaqftehtsavkirgkaiiqts
ygtldtekde
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3zzlB (B:)
snffvikakengvnvfgmtrgtdtrfhhsekldkgevmiaqftehtsavkirgkaiiqts
ygtldtekde
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>3zzlC (C:)
snffvikakengvnvfgmtrgtdtrfhhsekldkgevmiaqftehtsavkirgkaiiqts
ygtldtekde