PDB entry 3zzl

View 3zzl on RCSB PDB site
Description: bacillus halodurans trp RNA-binding attenuation protein (trap): a 12-subunit assembly
Class: transcription
Keywords: transcription, transcription regulation, protein engineering
Deposited on 2011-09-01, released 2011-10-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-10-26, with a file datestamp of 2011-10-21.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: 0.18051
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: transcription attenuation protein mtrb
  Species: Bacillus halodurans [TaxId:86665]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9KCC6 (0-69)
  Domains in SCOPe 2.08: d3zzla_
• Chain 'B':
  Compound: transcription attenuation protein mtrb
  Species: Bacillus halodurans [TaxId:86665]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9KCC6 (0-69)
  Domains in SCOPe 2.08: d3zzlb_
• Chain 'C':
  Compound: transcription attenuation protein mtrb
  Species: Bacillus halodurans [TaxId:86665]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9KCC6 (0-69)
  Domains in SCOPe 2.08: d3zzlc_
• Heterogens: TRP, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3zzlA (A:)
  snffvikakengvnvfgmtrgtdtrfhhsekldkgevmiaqftehtsavkirgkaiiqts
  ygtldtekde
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3zzlB (B:)
  snffvikakengvnvfgmtrgtdtrfhhsekldkgevmiaqftehtsavkirgkaiiqts
  ygtldtekde
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3zzlC (C:)
  snffvikakengvnvfgmtrgtdtrfhhsekldkgevmiaqftehtsavkirgkaiiqts
  ygtldtekde