PDB entry 3zzk

View 3zzk on RCSB PDB site
Description: Structure of an engineered aspartate aminotransferase
Class: transferase
Keywords: transferase
Deposited on 2011-09-01, released 2011-12-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-12-28, with a file datestamp of 2011-12-23.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: 0.17332
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aspartate aminotransferase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00509 (0-395)
      • engineered mutation (32)
      • engineered mutation (213)
      • engineered mutation (279)
    Domains in SCOPe 2.07: d3zzka_
  • Heterogens: PMP, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3zzkA (A:)
    mfenitaapadpilgladlfraderpgkinlgqgvykdetgktpvltsvkkaeqyllene
    ttknylgidgipefgrctqellfgkgsalindkrartaqtpggtgalrvaadflakntsv
    krvwvsnpswpnhksvfnsaglevreyayydaenhtldfdalinslneaqagdvvlfhgc
    chnptgidptleqwqtlaqlsvekgwlplfdfaqqgfargleedaeglrafaamhkeliv
    assysknfglynervgactlvaadsetvdrafsqmkaaiyanysnppahgasvvatilsn
    dalraiweqeltdmrqriqrmrqlfvntlqekganrdfsfiikqngmfsfsgltkeqvlr
    lreefgvyavasgrvnvagmtpdnmaplceaivavl