PDB entry 3zze

View 3zze on RCSB PDB site
Description: Crystal structure of C-MET kinase domain in complex with N'-((3Z)-4- chloro-7-methyl-2-oxo-1,2-dihydro-3H-indol-3-ylidene)-2-(4- hydroxyphenyl)propanohydrazide
Class: transferase
Keywords: transferase, inhibitor
Deposited on 2011-08-31, released 2011-09-14
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-10-10, with a file datestamp of 2012-10-05.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: 0.196
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hepatocyte growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3zzea_
  • Heterogens: 6XP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3zzeA (A:)
    mvhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihcav
    kslnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfi
    rnethnptvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfglardm
    ydkeyysvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvnt
    fditvyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfigehh
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zzeA (A:)
    npelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihcavkslnritdi
    gevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfirnethnptv
    kdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfglardmydkeyysvh
    nktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvntfditvyllq
    grrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfi