PDB entry 3zz2

View 3zz2 on RCSB PDB site
Description: Crystal Structure of Human Serine Threonine Kinase-10 Bound to 4-[(2,4-DICHLORO-5-METHOXYPHENYL)AMINO]-6- METHOXY-7-[3-(4-METHYLPIPERAZIN-1-YL)PROPOXY]QUINOLINE-3-CARBONITRILE apparently modified through radiation damage
Class: transferase
Keywords: transferase
Deposited on 2011-08-31, released 2011-11-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-10-10, with a file datestamp of 2012-10-05.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.21494
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine/threonine-protein kinase 10
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3zz2a_
  • Heterogens: D88, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3zz2A (A:)
    ehvrrdldpnevweivgelgdgafgkvykaknketgalaaakvietkseeeledyiveie
    ilatcdhpyivkllgayyhdgklwimiefcpggavdaimleldrgltepqiqvvcrqmle
    alnflhskriihrdlkagnvlmtlegdirladfgvsaknlktlqkrdsfigtpywmapev
    vmcetmkdtpydykadiwslgitliemaqiepphhelnpmrvllkiaksdpptlltpskw
    svefrdflkialdknpetrpsaaqllehpfvssitsnkalrelvaeakaevme
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zz2A (A:)
    ehvrrdldpnevweivgelgdgafgkvykaknketgalaaakvieeeledyiveieilat
    cdhpyivkllgayyhdgklwimiefcpggavdaimleldrgltepqiqvvcrqmlealnf
    lhskriihrdlkagnvlmtlegdirladfgvsaknlktlqpywmapevvmcetmkdtpyd
    ykadiwslgitliemaqiepphhelnpmrvllkiaksdpptlltpskwsvefrdflkial
    dknpetrpsaaqllehpfvssitsnkalrelvaeakaevme