PDB entry 3zya

View 3zya on RCSB PDB site
Description: Human p38 MAP Kinase in Complex with 2-amino-phenylamino- dibenzosuberone
Class: transferase
Keywords: transferase, allosteric regulation, protein kinase inhibitor, structure-activity relationship, p38 mitogen-activated protein kinases
Deposited on 2011-08-18, released 2011-12-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-02-01, with a file datestamp of 2012-01-27.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.1725
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16539 (6-End)
      • expression tag (1-5)
    Domains in SCOPe 2.06: d3zyaa1, d3zyaa2
  • Heterogens: 2A8, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3zyaA (A:)
    gshmlemsqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkk
    lsrpfqsiihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadln
    nivkcqkltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarh
    tddemtgyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlkl
    ilrlvgtpgaellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsd
    kritaaqalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppld
    qeemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zyaA (A:)
    shmlemsqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkkl
    srpfqsiihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnn
    ivkcqkltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglatrw
    yrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaell
    kkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqalahay
    faqyhdpddepvadpydqsfesrdllidewksltydevisfvpppl