PDB entry 3zy1

View 3zy1 on RCSB PDB site
Description: Crystal structure of the human p63 tetramerization domain
Class: transcription
Keywords: transcription, transcription factor, tetramerization domain, cell-cycle control
Deposited on 2011-08-16, released 2011-11-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Tumor protein 63
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9H3D4 (2-End)
  Domains in SCOPe 2.08: d3zy1a_

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >3zy1A (A:)
  gsdellylpvrgretyemllkikeslelmqylpqhtietyrqqqqq
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3zy1A (A:)
  dellylpvrgretyemllkikeslelmqylpqhtietyrq