PDB entry 3zy0

View 3zy0 on RCSB PDB site
Description: Crystal structure of a truncated variant of the human p63 tetramerization domain lacking the C-terminal helix
Class: transcription
Keywords: transcription, transcription factor, tetramerization domain, cell-cycle control
Deposited on 2011-08-16, released 2011-11-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-01-25, with a file datestamp of 2012-01-20.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.2064
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tumor protein p63
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zy0a_
  • Chain 'B':
    Compound: tumor protein p63
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zy0b_
  • Chain 'C':
    Compound: tumor protein p63
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zy0c_
  • Chain 'D':
    Compound: tumor protein p63
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zy0d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3zy0A (A:)
    gsdellylpvrgretyemllkikeslelmqyl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zy0A (A:)
    dellylpvrgretyemllkikeslelmqyl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3zy0B (B:)
    gsdellylpvrgretyemllkikeslelmqyl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zy0B (B:)
    llylpvrgretyemllkikeslelmqyl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3zy0C (C:)
    gsdellylpvrgretyemllkikeslelmqyl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zy0C (C:)
    llylpvrgretyemllkikeslelmqyl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3zy0D (D:)
    gsdellylpvrgretyemllkikeslelmqyl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zy0D (D:)
    llylpvrgretyemllkikeslelmq