PDB entry 3zxz

View 3zxz on RCSB PDB site
Description: X-ray Structure of PF-04217903 bound to the kinase domain of c-Met
Class: transferase
Keywords: transferase, inhibitor
Deposited on 2011-08-16, released 2011-08-31
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-10-10, with a file datestamp of 2012-10-05.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.185
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hepatocyte growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3zxza_
  • Heterogens: KRW, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3zxzA (A:)
    mvhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihcav
    kslnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfi
    rnethnptvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfglardm
    ydkeyysvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvnt
    fditvyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfigehh
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zxzA (A:)
    hidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtllkkihcavkslnri
    tdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfirnethn
    ptvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfglardmydkeyy
    svhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvntfditvy
    llqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfi