PDB entry 3zxw

View 3zxw on RCSB PDB site
Description: structure of activated rubisco from thermosynechococcus elongatus complexed with 2-carboxyarabinitol-1,5-diphosphate
Class: lyase
Keywords: co2/o2 specificity, carbon dioxide fixation, photosynthesis, thermostability, photorespiration, monooxygenase, hydroxylation, lyase, chloroplast, calvin cycle, thermophilic cyanobacteria
Deposited on 2011-08-16, released 2012-08-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-08-29, with a file datestamp of 2012-08-24.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.18276
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zxwa1, d3zxwa2
  • Chain 'B':
    Compound: ribulose bisphosphate carboxylase small chain
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zxwb_
  • Chain 'C':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zxwc1, d3zxwc2
  • Chain 'D':
    Compound: ribulose bisphosphate carboxylase small chain
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zxwd_
  • Chain 'E':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zxwe1, d3zxwe2
  • Chain 'F':
    Compound: ribulose bisphosphate carboxylase small chain
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zxwf_
  • Chain 'G':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zxwg1, d3zxwg2
  • Chain 'H':
    Compound: ribulose bisphosphate carboxylase small chain
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zxwh_
  • Heterogens: MG, CAP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3zxwA (A:)
    maytqsksqkvgyqagvkdyrltyytpdytpkdtdilaafrvtpqpgvpfeeaaaavaae
    sstgtwttvwtdlltdldrykgccydieplpgednqfiayiaypldlfeegsvtnmltsi
    vgnvfgfkalkalrledlripvaylktfqgpphgiqverdklnkygrpllgctikpklgl
    saknygravyeclrggldftkddeninsqpfqrwrdrflfvadaihkaqaetgeikghyl
    nvtaptceemlkraefakelempiimhdfltagftanttlskwcrdngmllhihramhav
    mdrqknhgihfrvlakclrmsggdhihtgtvvgklegdkavtlgfvdllrenyieqdrsr
    giyftqdwasmpgvmavasggihvwhmpalvdifgddavlqfgggtlghpwgnapgatan
    rvaleaciqarnegrdlmreggdiireaarwspelaaacelwkeikfefeaqdti
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zxwA (A:)
    gyqagvkdyrltyytpdytpkdtdilaafrvtpqpgvpfeeaaaavaaesstgtwttvwt
    dlltdldrykgccydieplpgednqfiayiaypldlfeegsvtnmltsivgnvfgfkalk
    alrledlripvaylktfqgpphgiqverdklnkygrpllgctikpklglsaknygravye
    clrggldftkddeninsqpfqrwrdrflfvadaihkaqaetgeikghylnvtaptceeml
    kraefakelempiimhdfltagftanttlskwcrdngmllhihramhavmdrqknhgihf
    rvlakclrmsggdhihtgtvvgklegdkavtlgfvdllrenyieqdrsrgiyftqdwasm
    pgvmavasggihvwhmpalvdifgddavlqfgggtlghpwgnapgatanrvaleaciqar
    negrdlmreggdiireaarwspelaaacelwkeikfefeaqdti
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3zxwB (B:)
    mktlpkerryetfsylpplsdaqiarqiqyaidqgyhpcvefnetsnaeirywtmwklpl
    fnctnaqdvlnevqqcrseypncfirvvafdnikqcqvmsfivykpnqansgysgyry
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zxwB (B:)
    sylpplsdaqiarqiqyaidqgyhpcvefnetsnaeirywtmwklplfnctnaqdvlnev
    qqcrseypncfirvvafdnikqcqvmsfivykp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3zxwC (C:)
    maytqsksqkvgyqagvkdyrltyytpdytpkdtdilaafrvtpqpgvpfeeaaaavaae
    sstgtwttvwtdlltdldrykgccydieplpgednqfiayiaypldlfeegsvtnmltsi
    vgnvfgfkalkalrledlripvaylktfqgpphgiqverdklnkygrpllgctikpklgl
    saknygravyeclrggldftkddeninsqpfqrwrdrflfvadaihkaqaetgeikghyl
    nvtaptceemlkraefakelempiimhdfltagftanttlskwcrdngmllhihramhav
    mdrqknhgihfrvlakclrmsggdhihtgtvvgklegdkavtlgfvdllrenyieqdrsr
    giyftqdwasmpgvmavasggihvwhmpalvdifgddavlqfgggtlghpwgnapgatan
    rvaleaciqarnegrdlmreggdiireaarwspelaaacelwkeikfefeaqdti
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zxwC (C:)
    gyqagvkdyrltyytpdytpkdtdilaafrvtpqpgvpfeeaaaavaaesstgtwttvwt
    dlltdldrykgccydieplpgednqfiayiaypldlfeegsvtnmltsivgnvfgfkalk
    alrledlripvaylktfqgpphgiqverdklnkygrpllgctikpklglsaknygravye
    clrggldftkddeninsqpfqrwrdrflfvadaihkaqaetgeikghylnvtaptceeml
    kraefakelempiimhdfltagftanttlskwcrdngmllhihramhavmdrqknhgihf
    rvlakclrmsggdhihtgtvvgklegdkavtlgfvdllrenyieqdrsrgiyftqdwasm
    pgvmavasggihvwhmpalvdifgddavlqfgggtlghpwgnapgatanrvaleaciqar
    negrdlmreggdiireaarwspelaaacelwkeikfefeaqdti
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3zxwD (D:)
    mktlpkerryetfsylpplsdaqiarqiqyaidqgyhpcvefnetsnaeirywtmwklpl
    fnctnaqdvlnevqqcrseypncfirvvafdnikqcqvmsfivykpnqansgysgyry
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zxwD (D:)
    sylpplsdaqiarqiqyaidqgyhpcvefnetsnaeirywtmwklplfnctnaqdvlnev
    qqcrseypncfirvvafdnikqcqvmsfivykp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3zxwE (E:)
    maytqsksqkvgyqagvkdyrltyytpdytpkdtdilaafrvtpqpgvpfeeaaaavaae
    sstgtwttvwtdlltdldrykgccydieplpgednqfiayiaypldlfeegsvtnmltsi
    vgnvfgfkalkalrledlripvaylktfqgpphgiqverdklnkygrpllgctikpklgl
    saknygravyeclrggldftkddeninsqpfqrwrdrflfvadaihkaqaetgeikghyl
    nvtaptceemlkraefakelempiimhdfltagftanttlskwcrdngmllhihramhav
    mdrqknhgihfrvlakclrmsggdhihtgtvvgklegdkavtlgfvdllrenyieqdrsr
    giyftqdwasmpgvmavasggihvwhmpalvdifgddavlqfgggtlghpwgnapgatan
    rvaleaciqarnegrdlmreggdiireaarwspelaaacelwkeikfefeaqdti
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zxwE (E:)
    gyqagvkdyrltyytpdytpkdtdilaafrvtpqpgvpfeeaaaavaaesstgtwttvwt
    dlltdldrykgccydieplpgednqfiayiaypldlfeegsvtnmltsivgnvfgfkalk
    alrledlripvaylktfqgpphgiqverdklnkygrpllgctikpklglsaknygravye
    clrggldftkddeninsqpfqrwrdrflfvadaihkaqaetgeikghylnvtaptceeml
    kraefakelempiimhdfltagftanttlskwcrdngmllhihramhavmdrqknhgihf
    rvlakclrmsggdhihtgtvvgklegdkavtlgfvdllrenyieqdrsrgiyftqdwasm
    pgvmavasggihvwhmpalvdifgddavlqfgggtlghpwgnapgatanrvaleaciqar
    negrdlmreggdiireaarwspelaaacelwkeikfefeaqdti
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3zxwF (F:)
    mktlpkerryetfsylpplsdaqiarqiqyaidqgyhpcvefnetsnaeirywtmwklpl
    fnctnaqdvlnevqqcrseypncfirvvafdnikqcqvmsfivykpnqansgysgyry
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zxwF (F:)
    sylpplsdaqiarqiqyaidqgyhpcvefnetsnaeirywtmwklplfnctnaqdvlnev
    qqcrseypncfirvvafdnikqcqvmsfivykp
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3zxwG (G:)
    maytqsksqkvgyqagvkdyrltyytpdytpkdtdilaafrvtpqpgvpfeeaaaavaae
    sstgtwttvwtdlltdldrykgccydieplpgednqfiayiaypldlfeegsvtnmltsi
    vgnvfgfkalkalrledlripvaylktfqgpphgiqverdklnkygrpllgctikpklgl
    saknygravyeclrggldftkddeninsqpfqrwrdrflfvadaihkaqaetgeikghyl
    nvtaptceemlkraefakelempiimhdfltagftanttlskwcrdngmllhihramhav
    mdrqknhgihfrvlakclrmsggdhihtgtvvgklegdkavtlgfvdllrenyieqdrsr
    giyftqdwasmpgvmavasggihvwhmpalvdifgddavlqfgggtlghpwgnapgatan
    rvaleaciqarnegrdlmreggdiireaarwspelaaacelwkeikfefeaqdti
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zxwG (G:)
    gyqagvkdyrltyytpdytpkdtdilaafrvtpqpgvpfeeaaaavaaesstgtwttvwt
    dlltdldrykgccydieplpgednqfiayiaypldlfeegsvtnmltsivgnvfgfkalk
    alrledlripvaylktfqgpphgiqverdklnkygrpllgctikpklglsaknygravye
    clrggldftkddeninsqpfqrwrdrflfvadaihkaqaetgeikghylnvtaptceeml
    kraefakelempiimhdfltagftanttlskwcrdngmllhihramhavmdrqknhgihf
    rvlakclrmsggdhihtgtvvgklegdkavtlgfvdllrenyieqdrsrgiyftqdwasm
    pgvmavasggihvwhmpalvdifgddavlqfgggtlghpwgnapgatanrvaleaciqar
    negrdlmreggdiireaarwspelaaacelwkeikfefeaqdti
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3zxwH (H:)
    mktlpkerryetfsylpplsdaqiarqiqyaidqgyhpcvefnetsnaeirywtmwklpl
    fnctnaqdvlnevqqcrseypncfirvvafdnikqcqvmsfivykpnqansgysgyry
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zxwH (H:)
    sylpplsdaqiarqiqyaidqgyhpcvefnetsnaeirywtmwklplfnctnaqdvlnev
    qqcrseypncfirvvafdnikqcqvmsfivykp