PDB entry 3zxt

View 3zxt on RCSB PDB site
Description: Dimeric structure of DAPK-1 catalytic domain in complex with AMPPCP- Mg
Class: transferase
Keywords: apoptosis, transferase, ATP binding
Deposited on 2011-08-15, released 2012-07-25
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-07-25, with a file datestamp of 2012-07-20.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.21947
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Death-associated protein kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3zxta_
  • Chain 'B':
    Compound: Death-associated protein kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3zxtb_
  • Chain 'C':
    Compound: Death-associated protein kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3zxtc_
  • Chain 'D':
    Compound: Death-associated protein kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3zxtd_
  • Heterogens: ACP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3zxtA (A:)
    mtvfrqenvddyydtgeelgsgqfavvkkcrekstglqyaakfikkrrtkssrrgvsred
    ierevsilkeiqhpnvitlhevyenktdvililelvaggelfdflaekeslteeeatefl
    kqilngvyylhslqiahfdlkpenimlldrnvpkprikiidfglahkidfgnefknifgt
    pefvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanvsavnyefedey
    fsntsalakdfirrllvkdpkkrmtiqdslqhpwikpkdtqqals
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zxtA (A:)
    envddyydtgeelgsgqfavvkkcrekstglqyaakfikkrrtredierevsilkeiqhp
    nvitlhevyenktdvililelvaggelfdflaekeslteeeateflkqilngvyylhslq
    iahfdlkpenimlldrvpkprikiidfglahkidefvapeivnyeplgleadmwsigvit
    yillsgaspflgdtkqetlanvsavnyefedeyfsntsalakdfirrllvkdpkkrmtiq
    dslqhpwik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3zxtB (B:)
    mtvfrqenvddyydtgeelgsgqfavvkkcrekstglqyaakfikkrrtkssrrgvsred
    ierevsilkeiqhpnvitlhevyenktdvililelvaggelfdflaekeslteeeatefl
    kqilngvyylhslqiahfdlkpenimlldrnvpkprikiidfglahkidfgnefknifgt
    pefvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanvsavnyefedey
    fsntsalakdfirrllvkdpkkrmtiqdslqhpwikpkdtqqals
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zxtB (B:)
    envddyydtgeelgsgqfavvkkcrekstglqyaakfikkrrtksrrgvsredierevsi
    lkeiqhpnvitlhevyenktdvililelvaggelfdflaeklteeeateflkqilngvyy
    lhslqiahfdlkpenimlldrnvpkprikiidfglahkidtpefvapeivnyeplglead
    mwsigvityilsgaspflgdtkqetlanvsavnyefedeyfsalakdfirrllvkdpkkr
    mtiqdslqhpwik
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3zxtC (C:)
    mtvfrqenvddyydtgeelgsgqfavvkkcrekstglqyaakfikkrrtkssrrgvsred
    ierevsilkeiqhpnvitlhevyenktdvililelvaggelfdflaekeslteeeatefl
    kqilngvyylhslqiahfdlkpenimlldrnvpkprikiidfglahkidfgnefknifgt
    pefvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanvsavnyefedey
    fsntsalakdfirrllvkdpkkrmtiqdslqhpwikpkdtqqals
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zxtC (C:)
    rqenvddyydtgeelgqfavvkkcrekstglqyaakfikkrrtkssrrgvsredierevs
    ilkeiqhpnvitlhevyenktdvililelvaggelfdflaekeslteeeateflkqilng
    vyylhslqiahfdlkpenimlldrnvpkprikiidfglahkidpefvapeivnyeplgle
    admwsigvityillsgaspflgdtkqetlanvsavnyefedeyfsntsalakdfirrllv
    kdpkkrmtiqdslqhpwik
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3zxtD (D:)
    mtvfrqenvddyydtgeelgsgqfavvkkcrekstglqyaakfikkrrtkssrrgvsred
    ierevsilkeiqhpnvitlhevyenktdvililelvaggelfdflaekeslteeeatefl
    kqilngvyylhslqiahfdlkpenimlldrnvpkprikiidfglahkidfgnefknifgt
    pefvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanvsavnyefedey
    fsntsalakdfirrllvkdpkkrmtiqdslqhpwikpkdtqqals
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zxtD (D:)
    envddyydtgeelgsgqfavvkkcrekstglqyaakfivsredierevsilkeiqhpnvi
    tlhevyenktdvililelvaggelfdflaeteeeateflkqilngvyylhslqiahfdlk
    penimlldrnvpkprikiidfglahkidtpefvapeivnyeplgleadmwsigvityill
    sgaspflgdtkqetlanvsavnyefedeyfsntsalakdfirrllvkdpkkrmtiqdslq
    hpwik