PDB entry 3zxi

View 3zxi on RCSB PDB site
Description: crystal structure of human mitochondrial tyrosyl-tRNA synthetase in complex with a tyrosyl-adenylate analog
Class: ligase
Keywords: aminoacyl-tRNA synthetase, protein-substrate complex, ATP-binding, ligase, protein biosynthesis
Deposited on 2011-08-11, released 2011-11-16
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.2277
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tyrosyl-tRNA synthetase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3zxia_
  • Chain 'B':
    Compound: tyrosyl-tRNA synthetase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3zxib_
  • Heterogens: TYA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3zxiA (A:)
    mrgshsgaqgllaaqkarglfkdffpetgtkielpelfdrgtasfpqtiycgfdptadsl
    hvghllallglfhlqraghnvialvggatarlgdpsgrtkerealetervranaralrlg
    lealaanhqqlftdgrswgsftvldnsawyqkqhlvdflaavgghfrmgtllsrqsvqlr
    lkspegmslaeffyqvlqaydfyylfqrygcrvqlggsdqlgnimsgyefinkltgedvf
    gitvplitsttgaklgksagnavwlnrdktspfelyqffvrqpddsverylklftflplp
    eidhimqlhvkeperrgpqkrlaaevtklvhgregldsakrctqalyhrshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zxiA (A:)
    gllaaqkarglfkdffppqtiycgfdptadslhvghllallglfhlqraghnvialvgga
    tarlgdpsgrtkerealetervranaralrlglealaanhqqlftdgrswgsftvldnsa
    wyqkqhlvdflaavgghfrmgtllsrqsvqlrlkspegmslaeffyqvlqaydfyylfqr
    ygcrvqlggsdqlgnimsgyefinkltgedvfgitvplitavwlnrdktspfelyqffvr
    qpddsverylklftflplpeidhimqlhvkeperrgpqkrlaaevtklvhgregldsakr
    ctqaly
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3zxiB (B:)
    mrgshsgaqgllaaqkarglfkdffpetgtkielpelfdrgtasfpqtiycgfdptadsl
    hvghllallglfhlqraghnvialvggatarlgdpsgrtkerealetervranaralrlg
    lealaanhqqlftdgrswgsftvldnsawyqkqhlvdflaavgghfrmgtllsrqsvqlr
    lkspegmslaeffyqvlqaydfyylfqrygcrvqlggsdqlgnimsgyefinkltgedvf
    gitvplitsttgaklgksagnavwlnrdktspfelyqffvrqpddsverylklftflplp
    eidhimqlhvkeperrgpqkrlaaevtklvhgregldsakrctqalyhrshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zxiB (B:)
    gllaaqkarglfkdffppqtiycgfdptadslhvghllallglfhlqraghnvialvgga
    tarlgdpsgrtkerealetervranaralrlglealaanhqqlftdgrswgsftvldnsa
    wyqkqhlvdflaavgghfrmgtllsrqsvqlrlkspegmslaeffyqvlqaydfyylfqr
    ygcrvqlggsdqlgnimsgyefinkltgedvfgitvplitavwlnrdktspfelyqffvr
    qpddsverylklftflplpeidhimqlhvkeperrgpqkrlaaevtklvhgregldsakr
    ctqaly