PDB entry 3zwv

View 3zwv on RCSB PDB site
Description: Crystal structure of ADP-ribosyl cyclase complexed with ara-2'F-ADP- ribose at 2.3 angstrom
Class: hydrolase
Keywords: hydrolase, cd38
Deposited on 2011-08-03, released 2011-11-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-01-25, with a file datestamp of 2012-01-20.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.21808
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribosyl cyclase
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zwva_
  • Chain 'B':
    Compound: ADP-ribosyl cyclase
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zwvb_
  • Chain 'C':
    Compound: ADP-ribosyl cyclase
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zwvc_
  • Chain 'D':
    Compound: ADP-ribosyl cyclase
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29241 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d3zwvd1, d3zwvd2
  • Chain 'E':
    Compound: ADP-ribosyl cyclase
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zwve_
  • Chain 'F':
    Compound: ADP-ribosyl cyclase
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zwvf_
  • Chain 'G':
    Compound: ADP-ribosyl cyclase
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zwvg_
  • Chain 'H':
    Compound: ADP-ribosyl cyclase
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zwvh_
  • Heterogens: AVU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3zwvA (A:)
    aaivptrelenvflgrckdyeitryldilprvrsdcsalwkdffkafsfknpcdldlgsy
    kdfftsaqqqlpknkvmfwsgvydeahdyantgrkyitledtlpgymlnslvwcgqranp
    gfnekvcpdfktcpvqaresfwgmasssyahsaegevtymvdgsnpkvpayrpdsffgky
    elpnltnkvtrvkvivlhrlgekiiekcgagslldleklvkakhfafdcvenpravlfll
    csdnpnarecrlakrfyria
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zwvA (A:)
    ivptrelenvflgrckdyeitryldilprvrsdcsalwkdffkafsfknpcdldlgsykd
    fftsaqqqlpknkvmfwsgvydeahdyantgrkyitledtlpgymlnslvwcgqranpgf
    nekvcpdfktcpvqaresfwgmasssyahsaegevtymvdgsnpkvpayrpdsffgkyel
    pnltnkvtrvkvivlhrlgekiiekcgagslldleklvkakhfafdcvenpravlfllcs
    dnpnarecrlakr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3zwvB (B:)
    aaivptrelenvflgrckdyeitryldilprvrsdcsalwkdffkafsfknpcdldlgsy
    kdfftsaqqqlpknkvmfwsgvydeahdyantgrkyitledtlpgymlnslvwcgqranp
    gfnekvcpdfktcpvqaresfwgmasssyahsaegevtymvdgsnpkvpayrpdsffgky
    elpnltnkvtrvkvivlhrlgekiiekcgagslldleklvkakhfafdcvenpravlfll
    csdnpnarecrlakrfyria
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zwvB (B:)
    ivptrelenvflgrckdyeitryldilprvrsdcsalwkdffkafsfknpcdldlgsykd
    fftsaqqqlpknkvmfwsgvydeahdyantgrkyitledtlpgymlnslvwcgqranpgf
    nekvcpdfktcpvqaresfwgmasssyahsaegevtymvdgsnpkvpayrpdsffgkyel
    pnltnkvtrvkvivlhrlgekiiekcgagslldleklvkakhfafdcvenpravlfllcs
    dnpnarecrlak
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3zwvC (C:)
    aaivptrelenvflgrckdyeitryldilprvrsdcsalwkdffkafsfknpcdldlgsy
    kdfftsaqqqlpknkvmfwsgvydeahdyantgrkyitledtlpgymlnslvwcgqranp
    gfnekvcpdfktcpvqaresfwgmasssyahsaegevtymvdgsnpkvpayrpdsffgky
    elpnltnkvtrvkvivlhrlgekiiekcgagslldleklvkakhfafdcvenpravlfll
    csdnpnarecrlakrfyria
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zwvC (C:)
    ivptrelenvflgrckdyeitryldilprvrsdcsalwkdffkafsfknpcdldlgsykd
    fftsaqqqlpknkvmfwsgvydeahdyantgrkyitledtlpgymlnslvwcgqranpgf
    nekvcpdfktcpvqaresfwgmasssyahsaegevtymvdgsnpkvpayrpdsffgkyel
    pnltnkvtrvkvivlhrlgekiiekcgagslldleklvkakhfafdcvenpravlfllcs
    dnpnarecrlak
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3zwvD (D:)
    aaivptrelenvflgrckdyeitryldilprvrsdcsalwkdffkafsfknpcdldlgsy
    kdfftsaqqqlpknkvmfwsgvydeahdyantgrkyitledtlpgymlnslvwcgqranp
    gfnekvcpdfktcpvqaresfwgmasssyahsaegevtymvdgsnpkvpayrpdsffgky
    elpnltnkvtrvkvivlhrlgekiiekcgagslldleklvkakhfafdcvenpravlfll
    csdnpnarecrlakrfyria
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zwvD (D:)
    aaivptrelenvflgrckdyeitryldilprvrsdcsalwkdffkafsfknpcdldlgsy
    kdfftsaqqqlpknkvmfwsgvydeahdyantgrkyitledtlpgymlnslvwcgqranp
    gfnekvcpdfktcpvqaresfwgmasssyahsaegevtymvdgsnpkvpayrpdsffgky
    elpnltnkvtrvkvivlhrlgekiiekcgagslldleklvkakhfafdcvenpravlfll
    csdnpnarecrl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3zwvE (E:)
    aaivptrelenvflgrckdyeitryldilprvrsdcsalwkdffkafsfknpcdldlgsy
    kdfftsaqqqlpknkvmfwsgvydeahdyantgrkyitledtlpgymlnslvwcgqranp
    gfnekvcpdfktcpvqaresfwgmasssyahsaegevtymvdgsnpkvpayrpdsffgky
    elpnltnkvtrvkvivlhrlgekiiekcgagslldleklvkakhfafdcvenpravlfll
    csdnpnarecrlakrfyria
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zwvE (E:)
    ivptrelenvflgrckdyeitryldilprvrsdcsalwkdffkafsfknpcdldlgsykd
    fftsaqqqlpknkvmfwsgvydeahdyantgrkyitledtlpgymlnslvwcgqranpgf
    nekvcpdfktcpvqaresfwgmasssyahsaegevtymvdgsnpkvpayrpdsffgkyel
    pnltnkvtrvkvivlhrlgekiiekcgagslldleklvkakhfafdcvenpravlfllcs
    dnpnarecrlak
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3zwvF (F:)
    aaivptrelenvflgrckdyeitryldilprvrsdcsalwkdffkafsfknpcdldlgsy
    kdfftsaqqqlpknkvmfwsgvydeahdyantgrkyitledtlpgymlnslvwcgqranp
    gfnekvcpdfktcpvqaresfwgmasssyahsaegevtymvdgsnpkvpayrpdsffgky
    elpnltnkvtrvkvivlhrlgekiiekcgagslldleklvkakhfafdcvenpravlfll
    csdnpnarecrlakrfyria
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zwvF (F:)
    ivptrelenvflgrckdyeitryldilprvrsdcsalwkdffkafsfknpcdldlgsykd
    fftsaqqqlpknkvmfwsgvydeahdyantgrkyitledtlpgymlnslvwcgqranpgf
    nekvcpdfktcpvqaresfwgmasssyahsaegevtymvdgsnpkvpayrpdsffgkyel
    pnltnkvtrvkvivlhrlgekiiekcgagslldleklvkakhfafdcvenpravlfllcs
    dnpnarecrlak
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3zwvG (G:)
    aaivptrelenvflgrckdyeitryldilprvrsdcsalwkdffkafsfknpcdldlgsy
    kdfftsaqqqlpknkvmfwsgvydeahdyantgrkyitledtlpgymlnslvwcgqranp
    gfnekvcpdfktcpvqaresfwgmasssyahsaegevtymvdgsnpkvpayrpdsffgky
    elpnltnkvtrvkvivlhrlgekiiekcgagslldleklvkakhfafdcvenpravlfll
    csdnpnarecrlakrfyria
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zwvG (G:)
    ivptrelenvflgrckdyeitryldilprvrsdcsalwkdffkafsfknpcdldlgsykd
    fftsaqqqlpknkvmfwsgvydeahdyantgrkyitledtlpgymlnslvwcgqranpgf
    nekvcpdfktcpvqaresfwgmasssyahsaegevtymvdgsnpkvpayrpdsffgkyel
    pnltnkvtrvkvivlhrlgekiiekcgagslldleklvkakhfafdcvenpravlfllcs
    dnpnarecrlak
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3zwvH (H:)
    aaivptrelenvflgrckdyeitryldilprvrsdcsalwkdffkafsfknpcdldlgsy
    kdfftsaqqqlpknkvmfwsgvydeahdyantgrkyitledtlpgymlnslvwcgqranp
    gfnekvcpdfktcpvqaresfwgmasssyahsaegevtymvdgsnpkvpayrpdsffgky
    elpnltnkvtrvkvivlhrlgekiiekcgagslldleklvkakhfafdcvenpravlfll
    csdnpnarecrlakrfyria
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zwvH (H:)
    ivptrelenvflgrckdyeitryldilprvrsdcsalwkdffkafsfknpcdldlgsykd
    fftsaqqqlpknkvmfwsgvydeahdyantgrkyitledtlpgymlnslvwcgqranpgf
    nekvcpdfktcpvqaresfwgmasssyahsaegevtymvdgsnpkvpayrpdsffgkyel
    pnltnkvtrvkvivlhrlgekiiekcgagslldleklvkakhfafdcvenpravlfllcs
    dnpnarecrlak