PDB entry 3zwh

View 3zwh on RCSB PDB site
Description: Ca2+-bound S100A4 C3S, C81S, C86S and F45W mutant complexed with myosin IIA
Class: ca-binding protein/motor protein
Keywords: ca-binding protein-motor protein complex, s100 proteins, ef-hand
Deposited on 2011-07-31, released 2012-04-04
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-05-23, with a file datestamp of 2012-05-18.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.1768
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein S100-A4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26447
      • engineered mutation (5)
      • engineered mutation (47)
      • engineered mutation (83)
      • engineered mutation (88)
    Domains in SCOPe 2.02: d3zwha_
  • Chain 'B':
    Compound: Protein S100-A4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26447 (3-End)
      • engineered mutation (5)
      • engineered mutation (47)
      • engineered mutation (83)
      • engineered mutation (88)
    Domains in SCOPe 2.02: d3zwhb_
  • Chain 'Q':
    Compound: myosin-9
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35579 (1-End)
      • engineered mutation (0)
  • Heterogens: CA, ACT, AZI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3zwhA (A:)
    gshmasplekaldvmvstfhkysgkegdkfklnkselkelltrelpswlgkrtdeaafqk
    lmsnldsnrdnevdfqeycvflssiammsneffegfpdkqprkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zwhA (A:)
    asplekaldvmvstfhkysgkegdkfklnkselkelltrelpswlgkrtdeaafqklmsn
    ldsnrdnevdfqeycvflssiammsneffegfp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3zwhB (B:)
    gshmasplekaldvmvstfhkysgkegdkfklnkselkelltrelpswlgkrtdeaafqk
    lmsnldsnrdnevdfqeycvflssiammsneffegfpdkqprkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zwhB (B:)
    masplekaldvmvstfhkysgkegdkfklnkselkelltrelpswlgkrtdeaafqklms
    nldsnrdnevdfqeycvflssiammsneffegfpdkqpr
    

  • Chain 'Q':
    No sequence available.