PDB entry 3zv3

View 3zv3 on RCSB PDB site
Description: crystal structure of cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase (bphb)from pandoraea pnomenusa strain b-356 in intermediate state of substrate binding loop
Class: oxidoreductase
Keywords: oxidoreductase, short chain dehydrogenase/oxidoreductase, sdr, comamonas testosteroni
Deposited on 2011-07-23, released 2011-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-10-26, with a file datestamp of 2011-10-21.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.26917
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase
    Species: PANDORAEA PNOMENUSA [TaxId:93220]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zv3a_
  • Chain 'B':
    Compound: cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase
    Species: PANDORAEA PNOMENUSA [TaxId:93220]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zv3b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3zv3A (A:)
    mkltgevalitggasglgralvdrfvaegarvavldksaerlrelevahggnavgvvgdv
    rslqdqkraaerclaafgkidtlipnagiwdystaladlpedkidaafddifhvnvkgyi
    havkaclpalvssrgsvvftisnagfypngggplytatkhavvglvrqmafelaphvrvn
    gvapggmntdlrgpsslglseqsissvpladmlksvlpigrmpaleeytgayvffatrgd
    slpatgallnydggmgvrgfltaaggadlpeklninregqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zv3A (A:)
    mkltgevalitggasglgralvdrfvaegarvavldksaerlrelevahggnavgvvgdv
    rslqdqkraaerclaafgkidtlipnagiwdystaladlpedkidaafddifhvnvkgyi
    havkaclpalvssrgsvvftisnagfypngggplytatkhavvglvrqmafelaphvrvn
    gvapggmntsvpladmlksvlpigrmpaleeytgayvffatrgdslpatgallnydggmg
    vrgfltaaggadlpeklnin
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3zv3B (B:)
    mkltgevalitggasglgralvdrfvaegarvavldksaerlrelevahggnavgvvgdv
    rslqdqkraaerclaafgkidtlipnagiwdystaladlpedkidaafddifhvnvkgyi
    havkaclpalvssrgsvvftisnagfypngggplytatkhavvglvrqmafelaphvrvn
    gvapggmntdlrgpsslglseqsissvpladmlksvlpigrmpaleeytgayvffatrgd
    slpatgallnydggmgvrgfltaaggadlpeklninregqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zv3B (B:)
    mkltgevalitggasglgralvdrfvaegarvavldksaerlrelevahggnavgvvgdv
    rslqdqkraaerclaafgkidtlipnagiwdystaladlpedkidaafddifhvnvkgyi
    havkaclpalvssrgsvvftisnagfypngggplytatkhavvglvrqmafelaphvrvn
    gvapggmntdlrgpsslglseqsissvpladmlksvlpigrmpaleeytgayvffatrgd
    slpatgallnydggmgvrgfltaaggadlpeklnin