PDB entry 3zul

View 3zul on RCSB PDB site
Description: padron on (fluorescent) icis intermediate state
Class: fluorescent protein
Keywords: gfp variants, fluorescent protein, positive, photoswitching, fps, rsfps, cryo-probe, isomerization
Deposited on 2011-07-19, released 2011-11-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-11-09, with a file datestamp of 2011-11-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.2058
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5TLG6 (0-End)
      • conflict (57)
      • chromophore (61)
      • conflict (92)
      • conflict (139)
      • conflict (153)
      • conflict (157)
      • conflict (188)
    Domains in SCOPe 2.06: d3zula_
  • Chain 'B':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5TLG6 (0-End)
      • conflict (57)
      • chromophore (61)
      • conflict (92)
      • conflict (139)
      • conflict (153)
      • conflict (157)
      • conflict (188)
    Domains in SCOPe 2.06: d3zulb_
  • Chain 'C':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5TLG6 (0-End)
      • conflict (57)
      • chromophore (61)
      • conflict (92)
      • conflict (139)
      • conflict (153)
      • conflict (157)
      • conflict (188)
    Domains in SCOPe 2.06: d3zulc_
  • Chain 'D':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5TLG6 (0-End)
      • conflict (57)
      • chromophore (61)
      • conflict (92)
      • conflict (139)
      • conflict (153)
      • conflict (157)
      • conflict (188)
    Domains in SCOPe 2.06: d3zuld_
  • Chain 'E':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5TLG6 (0-End)
      • conflict (57)
      • chromophore (61)
      • conflict (92)
      • conflict (139)
      • conflict (153)
      • conflict (157)
      • conflict (188)
    Domains in SCOPe 2.06: d3zule_
  • Chain 'F':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5TLG6 (0-End)
      • conflict (57)
      • chromophore (61)
      • conflict (92)
      • conflict (139)
      • conflict (153)
      • conflict (157)
      • conflict (188)
    Domains in SCOPe 2.06: d3zulf_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3zulA (A:)
    svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydiltmaf
    cygnrvfakypenivdyfkqsfpegyswersmiyedggicnatnditldgdcyiyeirfd
    gvnfpangpvmqkrtvkwelsteklyvrdgvlksdgnyalsleggghyrcdfkttykakk
    vvqlpdyhsvdhhieikshdkdysnvnlhehaeahselprqak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zulA (A:)
    svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydiltmaf
    cygnrvfakypenivdyfkqsfpegyswersmiyedggicnatnditldgdcyiyeirfd
    gvnfpangpvmqkrtvkwelsteklyvrdgvlksdgnyalsleggghyrcdfkttykakk
    vvqlpdyhsvdhhieikshdkdysnvnlhehaeahs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3zulB (B:)
    svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydiltmaf
    cygnrvfakypenivdyfkqsfpegyswersmiyedggicnatnditldgdcyiyeirfd
    gvnfpangpvmqkrtvkwelsteklyvrdgvlksdgnyalsleggghyrcdfkttykakk
    vvqlpdyhsvdhhieikshdkdysnvnlhehaeahselprqak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zulB (B:)
    svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydiltmaf
    cygnrvfakypenivdyfkqsfpegyswersmiyedggicnatnditldgdcyiyeirfd
    gvnfpangpvmqkrtvkwelsteklyvrdgvlksdgnyalsleggghyrcdfkttykakk
    vvqlpdyhsvdhhieikshdkdysnvnlhehaeahs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3zulC (C:)
    svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydiltmaf
    cygnrvfakypenivdyfkqsfpegyswersmiyedggicnatnditldgdcyiyeirfd
    gvnfpangpvmqkrtvkwelsteklyvrdgvlksdgnyalsleggghyrcdfkttykakk
    vvqlpdyhsvdhhieikshdkdysnvnlhehaeahselprqak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zulC (C:)
    svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydiltmaf
    cygnrvfakypenivdyfkqsfpegyswersmiyedggicnatnditldgdcyiyeirfd
    gvnfpangpvmqkrtvkwelsteklyvrdgvlksdgnyalsleggghyrcdfkttykakk
    vvqlpdyhsvdhhieikshdkdysnvnlhehaeahsel
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3zulD (D:)
    svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydiltmaf
    cygnrvfakypenivdyfkqsfpegyswersmiyedggicnatnditldgdcyiyeirfd
    gvnfpangpvmqkrtvkwelsteklyvrdgvlksdgnyalsleggghyrcdfkttykakk
    vvqlpdyhsvdhhieikshdkdysnvnlhehaeahselprqak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zulD (D:)
    svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydiltmaf
    cygnrvfakypenivdyfkqsfpegyswersmiyedggicnatnditldgdcyiyeirfd
    gvnfpangpvmqkrtvkwelsteklyvrdgvlksdgnyalsleggghyrcdfkttykakk
    vvqlpdyhsvdhhieikshdkdysnvnlhehaeahs
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3zulE (E:)
    svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydiltmaf
    cygnrvfakypenivdyfkqsfpegyswersmiyedggicnatnditldgdcyiyeirfd
    gvnfpangpvmqkrtvkwelsteklyvrdgvlksdgnyalsleggghyrcdfkttykakk
    vvqlpdyhsvdhhieikshdkdysnvnlhehaeahselprqak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zulE (E:)
    svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydiltmaf
    cygnrvfakypenivdyfkqsfpegyswersmiyedggicnatnditldgdcyiyeirfd
    gvnfpangpvmqkrtvkwelsteklyvrdgvlksdgnyalsleggghyrcdfkttykakk
    vvqlpdyhsvdhhieikshdkdysnvnlhehaeahs
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3zulF (F:)
    svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydiltmaf
    cygnrvfakypenivdyfkqsfpegyswersmiyedggicnatnditldgdcyiyeirfd
    gvnfpangpvmqkrtvkwelsteklyvrdgvlksdgnyalsleggghyrcdfkttykakk
    vvqlpdyhsvdhhieikshdkdysnvnlhehaeahselprqak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zulF (F:)
    svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydiltmaf
    cygnrvfakypenivdyfkqsfpegyswersmiyedggicnatnditldgdcyiyeirfd
    gvnfpangpvmqkrtvkwelsteklyvrdgvlksdgnyalsleggghyrcdfkttykakk
    vvqlpdyhsvdhhieikshdkdysnvnlhehaeahs