PDB entry 3zuj

View 3zuj on RCSB PDB site
Description: padron on (fluorescent) abcis
Class: fluorescent protein
Keywords: gfp variants, fluorescent protein, positive photoswitching, fps, rsfps, cryo-probe, intermediate state, isomerization
Deposited on 2011-07-19, released 2011-08-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-11-09, with a file datestamp of 2011-11-04.
Experiment type: XRAY
Resolution: 2.34 Å
R-factor: 0.1906
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5TLG6 (0-215)
      • conflict (57-58)
      • chromophore (61)
      • conflict (92)
      • conflict (139)
      • conflict (153)
      • conflict (155)
      • conflict (157)
      • conflict (188)
    Domains in SCOPe 2.06: d3zuja_
  • Chain 'B':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5TLG6 (0-215)
      • conflict (57-58)
      • chromophore (61)
      • conflict (92)
      • conflict (139)
      • conflict (153)
      • conflict (155)
      • conflict (157)
      • conflict (188)
    Domains in SCOPe 2.06: d3zujb_
  • Chain 'C':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5TLG6 (Start-215)
      • conflict (57-58)
      • chromophore (61)
      • conflict (92)
      • conflict (139)
      • conflict (153)
      • conflict (155)
      • conflict (157)
      • conflict (188)
    Domains in SCOPe 2.06: d3zujc_
  • Chain 'D':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5TLG6 (Start-215)
      • conflict (57-58)
      • chromophore (61)
      • conflict (92)
      • conflict (139)
      • conflict (153)
      • conflict (155)
      • conflict (157)
      • conflict (188)
    Domains in SCOPe 2.06: d3zujd_
  • Chain 'E':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5TLG6 (0-215)
      • conflict (57-58)
      • chromophore (61)
      • conflict (92)
      • conflict (139)
      • conflict (153)
      • conflict (155)
      • conflict (157)
      • conflict (188)
    Domains in SCOPe 2.06: d3zuje_
  • Chain 'F':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5TLG6 (0-215)
      • conflict (57-58)
      • chromophore (61)
      • conflict (92)
      • conflict (139)
      • conflict (153)
      • conflict (155)
      • conflict (157)
      • conflict (188)
    Domains in SCOPe 2.06: d3zujf_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3zujA (A:)
    svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydiltmaf
    cygnrvfakypenivdyfkqsfpegyswersmiyedggicnatnditldgdcyiyeirfd
    gvnfpangpvmqkrtvkwelsteklyvrdgvlksdgnyalsleggghyrcdfkttykakk
    vvqlpdyhsvdhhieikshdkdysnvnlhehaeahs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3zujB (B:)
    svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydiltmaf
    cygnrvfakypenivdyfkqsfpegyswersmiyedggicnatnditldgdcyiyeirfd
    gvnfpangpvmqkrtvkwelsteklyvrdgvlksdgnyalsleggghyrcdfkttykakk
    vvqlpdyhsvdhhieikshdkdysnvnlhehaeahs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3zujC (C:)
    svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydiltmaf
    cygnrvfakypenivdyfkqsfpegyswersmiyedggicnatnditldgdcyiyeirfd
    gvnfpangpvmqkrtvkwelsteklyvrdgvlksdgnyalsleggghyrcdfkttykakk
    vvqlpdyhsvdhhieikshdkdysnvnlhehaeahs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zujC (C:)
    vikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydiltmafc
    ygnrvfakypenivdyfkqsfpegyswersmiyedggicnatnditldgdcyiyeirfdg
    vnfpangpvmqkrtvkwelsteklyvrdgvlksdgnyalsleggghyrcdfkttykakkv
    vqlpdyhsvdhhieikshdkdysnvnlhehaeahs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3zujD (D:)
    svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydiltmaf
    cygnrvfakypenivdyfkqsfpegyswersmiyedggicnatnditldgdcyiyeirfd
    gvnfpangpvmqkrtvkwelsteklyvrdgvlksdgnyalsleggghyrcdfkttykakk
    vvqlpdyhsvdhhieikshdkdysnvnlhehaeahs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zujD (D:)
    ikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydiltmafcy
    gnrvfakypenivdyfkqsfpegyswersmiyedggicnatnditldgdcyiyeirfdgv
    nfpangpvmqkrtvkwelsteklyvrdgvlksdgnyalsleggghyrcdfkttykakkvv
    qlpdyhsvdhhieikshdkdysnvnlhehaeahs
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3zujE (E:)
    svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydiltmaf
    cygnrvfakypenivdyfkqsfpegyswersmiyedggicnatnditldgdcyiyeirfd
    gvnfpangpvmqkrtvkwelsteklyvrdgvlksdgnyalsleggghyrcdfkttykakk
    vvqlpdyhsvdhhieikshdkdysnvnlhehaeahs
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3zujF (F:)
    svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydiltmaf
    cygnrvfakypenivdyfkqsfpegyswersmiyedggicnatnditldgdcyiyeirfd
    gvnfpangpvmqkrtvkwelsteklyvrdgvlksdgnyalsleggghyrcdfkttykakk
    vvqlpdyhsvdhhieikshdkdysnvnlhehaeahs