PDB entry 3zuc

View 3zuc on RCSB PDB site
Description: Structure of CBM3b of major scaffoldin subunit ScaA from Acetivibrio cellulolyticus determined from the crystals grown in the presence of Nickel
Class: crystalline cellulose-binding protein
Keywords: crystalline cellulose-binding protein, sugar binding protein, cellulosome
Deposited on 2011-07-18, released 2012-01-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-03-29, with a file datestamp of 2017-03-24.
Experiment type: XRAY
Resolution: 1 Å
R-factor: N/A
AEROSPACI score: 0.82 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cellulosomal scaffoldin
  Species: Acetivibrio cellulolyticus [TaxId:35830]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9RPL0 (4-152)
    • expression tag (0-3)
  Domains in SCOPe 2.07: d3zuca1, d3zuca2
• Heterogens: CA, EDO, NI, 1PE, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3zucA (A:)
  gshmnlkveffnagtqaqsnsiypkfrltntgsnainladvklhyyftvdgdkaqtfwcd
  wspvgssnvtgtfvkmnptttgadqyleiafssaagtlaantsievqgrfaksdwtnynq
  addysfnssattytswdkvtaysaegliwgiep